KEGG   Canis familiaris (dog): 482940Help
Entry
482940            CDS       T01007                                 

Definition
ubiquitin carboxyl-terminal hydrolase 17-like protein 17-like
Orthology
K11845  
ubiquitin carboxyl-terminal hydrolase 17 [EC:3.1.2.15]
Organism
cfa  Canis familiaris (dog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
16
AA seq 524 aa AA seqDB search
MALGASLGTLKGDSAGPLGSLLHNQAVSPDTGLASRQRGVSDRHLLGTSRSTRWAEANFR
ASEMRGGMGRESYVRGLSTWFHQQGRLRDRRPPGGVDGHRHHGTTCRRQTSCMLCTLQAH
LMRVLCHPGRVLRPLPLLLAAFHRHKQEDAHEYLMFILDAMQQACLPEDKLSDPECPQDS
TLIQQLFGGYWRSQIQCLHCQGISSTLEPYLDISLDIGDAHSVSQALEQLVKPELLEGEN
GYHCSKCLEKVPASKVLTLHTSPKVLILVLRRFSDLTGNKMTKEVQYPERLDMQHYLSEQ
RAGPLVYVLYAVLVYAGRSCHSGHYFCFVKAGNGQWYKMDDAKVSACDVTCALRQPAYVL
FYMQKTDLERDLGRESVEEGGLASPEADPTVVGEASGEPATDPSVNHPELEERGEETSRQ
QMTLDQWRCLQECNRPKPELNVRRREIALPANAVILHHSKYRPEMPKNHPQQTVDLLTTA
AGMLPPQVAGDVAKVPRVPGRARPTKRTSKKGQRSGEAVQGCVS
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggccctgggagccagcctggggaccctcaagggagactctgcagggcctcttggctct
ctgctgcacaaccaggctgtcagccctgacacagggttggcgagccggcagaggggtgtc
agtgatcggcacttgctgggcacctcgaggtccaccaggtgggctgaggctaactttagg
gcttctgagatgagaggtggaatgggacgggagtcttatgtcagggggctgagtacgtgg
ttccatcagcagggcaggctcagggatagaaggcctcctggtggtgtagacgggcatcgg
catcacgggaccacctgtaggaggcagacatcctgcatgctgtgtaccctgcaggctcac
ctgatgcgggttctctgccatcctggacgtgtgctccggcccctgccactcctgctcgcc
gccttccacagacacaagcaggaagatgcccatgagtatctcatgttcattctggatgca
atgcagcaagcgtgcttgcctgaggacaagctctcagaccctgagtgtcctcaggacagc
accctcatccagcaactctttggggggtactggaggtctcaaatccagtgtctccactgc
caaggcatttcgagcactctggaaccttacctggacatcagcctggacatcggggatgct
cacagcgtcagccaagctttggagcagttggtgaagcccgaactgctggaaggtgaaaat
ggctaccattgtagtaagtgtctggagaaggtgcctgcgtccaaggtgttgactttgcac
acttccccgaaggtcctcatcctggtcttgagacgattctcagacttgacaggcaacaaa
atgactaaggaggtgcaatatcctgagcgccttgacatgcaacactacctgtctgagcag
agggcaggacccttggtttatgtgctctatgccgtgctggtgtacgctgggaggagttgc
cacagcggacattacttctgttttgtaaaggcaggaaatggccagtggtataaaatggat
gatgctaaggtcagcgcctgtgatgtgacttgcgcgctgcgccaacctgcctatgtcctc
ttttatatgcagaagactgatctggagagagaccttgggagggagtcagtcgaggaggga
ggactcgcatctcccgaggcagaccccacggtggtgggtgaggcctcaggagagccggca
acggatccctccgtgaaccatcctgagttggaggagcgtggggaagagacctccagacaa
caaatgacattagaccagtggagatgcctccaagaatgcaaccgccctaagcctgaactt
aatgtcaggagaagagaaattgctcttcctgcgaacgcagtcatccttcaccactccaaa
tacagacctgagatgccgaagaatcatcctcagcagaccgtcgacctgctcaccactgcg
gctgggatgctcccacctcaggtggccggggacgtggccaaagtcccgcgtgtgccaggg
agagcccgacctaccaagaggacgagcaagaagggacagaggtctggggaagcagtccag
ggatgtgtctcctaa

DBGET integrated database retrieval system