KEGG   Canis familiaris (dog): 483009Help
Entry
483009            CDS       T01007                                 

Gene name
CAD
Definition
carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase
Orthology
K11540  
carbamoyl-phosphate synthase / aspartate carbamoyltransferase / dihydroorotase [EC:6.3.5.5 2.1.3.2 3.5.2.3]
Organism
cfa  Canis familiaris (dog)
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:cfa00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:cfa00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
17
AA seq 2242 aa AA seqDB search
MAALMLEDGSVLRGQPFGAAVSTAGEVVFQTGMVGYPEALTDPSYKAQILVLTYPLIGNY
GIPTDEVDEFGLSKWFESSGIHVAGLVVGECCPTPSHWSATRTLHQWLQQHGIPGLQGVD
TRELTKKLREQGSLLGKLVQDGTEPSALPFLDPNARPLVPEVSIKAPRVFNAGGTPRILA
LDCGLKYNQIRCLCQRGAEVTVVPWDHTLDSQEYEGVFLSNGPGDPASYPSVVSTLSRVI
SEPNPRPVFGICLGHQLLALAIGAKTYKMRYGNRGHNQPCLLVGSGRCFLTSQNHGFAVE
TDSLPAGWLPLFTNANDRSNEGIVHDSLPFFSVQFHPEHQAGPSDMELLFDIFLETVKEA
TAGNPGGWTVRERLIERLCPPGIPTPGSGLPPPRKVLILGSGGLSIGQAGEFDYSGSQAI
KALKEENIQTLLINPNIATVQTSQGLADKVYFLPITPHYVTQVIRNERPDGILLTFGGQT
ALNCGVELTKAGVLARYGVRVLGTPVETIELTEDRRAFASRMAEIGEHVAPSEAASSLEQ
AQAAAERLGYPVLVRAAFALGGLGSGFASNRDELSALVAPAFAHTSQVLVDKSLKGWKEI
EYEVVRDAYGNCVTVCNMENLDPLGIHTGESIVVAPSQTLNDREYQLLRQTAIKVTQHLG
IVGECNVQYALNPESEQYYIIEVNARLSRSSALASKATGYPLAYVAAKLALGIPLPELRN
SVTGGTAAFEPSLDYCVVKIPRWDLSKFLRVSTKIGSCMKSVGEVMGIGRSFEEAFQKAL
RMVDENCVGFDHTVKPVSDMELETPTDKRIFVVAAALWAGYSVERLYQLTRIDRWFLHRM
KRIIAHAQLLEQHRGQPLPPDLLHQAKRLGFSDKQIALAVLSTELAVRKLRQELGICPAV
KQIDTVAAEWPAQTNYLYLTYWGTTHDLTFRTPHVLVLGSGVYRIGSSVEFDWCAVGCIR
QLRKMGYKTIMVNYNPETVSTDYDMCDRLYFDEISFEVVMDIYELENPEGVILSMGGQLP
NNMAMALHRQQCRVLGTSPEAIDSAENRFKFSRLLDTIGISQPQWRELSDLESARQFCQT
VGYPCVVRPSYVLSGAAMNVAYTDGDLERFLSSAAAVSKEHPVVISKFIQEAKEIDVDAV
ARDGVVAAIAISEHVENAGVHSGDATLVTPPQDITAKTLERIKAIVHAVGQELQVTGPFN
LQLIAKDDQLKVIECNVRVSRSFPFVSKTLGVDLVALATRVIMGEEVEPVGLMTGSGVVG
VKVPQFSFSRLAGADVVLGVEMTSTGEVAGFGESRCEAYLKAMLSTGFKIPKKNILLTIG
SYKNKSELLPTVRLLESLGYSLYASLGTADFYTEHGVKVTAVDWHFEEAVDGECPPQRSI
LEQLAENHFELVINLSMRGAGGRRLSSFVTKGYRTRRLAADFSVPLIIDIKCTKLFVEAL
GQIGPAPPLKVHVDCMTSQKLVRLPGLIDIHVHLREPGGTHKEDFASGTAAALAGGITMV
CAMPNTRPPIIDAPALALAQKLAEAGARCDFTLFLGASSENAGTLGAVAGSAAGLKLYLN
ETFSELRLDNVAQWMEHFETWPSHLPIVAHAERQNVAAILMVAQLTQRSVHICHVARKEE
ILLIKAAKARGLPVTCEVAPHHLFLSCDDLERLGPGKGEVRPELGSRQDVEALWENMAVI
DCFASDHAPHTLEEKCGPRPPPGFPGLETMLPLLLTAVSEGRLSLDDLLQRLHHNPRRIF
HLPPQEDTYVEVDLEHEWTIPSHMPFSKAHWTPFEGQKVKGTVRRVVLRGEVAYIDGQVL
VPPGYGQDVRKWPQGTVPQLAPPAPAASEITTTPERPRRAVPGLPDGRFHLPPRIHRASD
PGLPAVFLRPGAGIPRGSRTWAEEPKEKSSRKAAEPELMGTLDGTCYPPPPVPRQASPQN
LGTPGLLHPQTSPLLHSLVGQHILSVQQFTKDQMSHLFNVAHTLRMMVQKERSLDILKGK
VMASMFYEVSTRTSSSFAAAMARLGGAVLSFSEATSSVQKGESLADSVQTMSCYADVVVL
RHPQPGAVELAAKHCRRPVINAGDGVGEHPTQALLDIFTIREELGTVNGMTITMVGDLKH
GRTVHSLACLLTQYRVSLRYVAPPSLRMPSNVRAFVAARGTKQEEFESIEEALPDTDVLY
MTRIQKERFESSQEYEACFGQFILTPHIMTRAKKKMVVMHPMPRVNEISVEVDSDPRAAY
FRQAENGMYIRMALLATVLGRF
NT seq 6729 nt NT seq  +upstreamnt  +downstreamnt
atggcggccctgatgttggaagatgggtcggtcctgcggggccagccctttggggccgct
gtgtcgactgccggggaagtggtgtttcaaaccggtatggtcggctaccccgaggctctc
actgacccttcctacaaagcacaaatcttagtgctgacatatcctctgatcggcaactat
ggcatccccacagatgaagtggatgagttcggtctcagtaagtggtttgaatcctcgggg
atccatgtggcaggactggtggtgggagagtgctgtcccacgcccagccactggagtgcc
acccgcaccctgcaccagtggctgcaacagcatggcatacctggcctgcaaggagtggat
actcgagagctgactaagaagttgcgagagcaagggtctctgctgggaaagctggtccag
gatgggacagagccttcagccctgccattcttggaccccaatgcccgtcccctggtgcca
gaggtctcaattaaggctccaagggtattcaatgcagggggcactcctcggatccttgct
ttggattgtggccttaagtataatcagatccgatgcctgtgccagcgtggagctgaggtc
actgtggtaccttgggaccacacattagacagccaggagtatgagggtgtcttcctgagt
aatggccctggtgaccctgcctcctatcccagtgtggtatccacactgagccgtgtcata
tctgagcctaatccccgacctgtcttcgggatctgtctgggacaccagctgttggcctta
gccattggggccaagacatacaagatgagatacggaaaccgaggacataatcagccatgc
ttgctggtaggctctgggcgctgctttctgacatcccagaaccatgggtttgctgtggaa
acagactcattgccagcaggatggcttccactctttaccaacgccaatgatcgttccaat
gaaggcattgtacatgatagcctgccattcttcagtgtccagtttcacccagagcaccaa
gctggtccttcagatatggagcttctttttgatatctttctggaaactgtgaaagaagcc
acagctgggaaccctgggggctggacagttcgtgagcggctcattgagcgtctctgtccg
cctggaattcctacccccggctctgggcttccaccaccacgaaaggttctgattttaggc
tctgggggcctctccattggccaagctggagagtttgactactcaggctctcaggcaatt
aaggccctaaaggaggaaaacatccagacattgctgatcaaccccaacattgccacagtg
cagacttcccaggggctggctgacaaagtctatttccttcccataacacctcactatgta
actcaggtgatccgcaatgagcgcccagatggcatattactgacttttgggggccaaaca
gctctgaactgtggtgtggagctgaccaaggccggagtattagcgcggtatggggtccgg
gtcctgggcacacctgtggaaaccattgaactgactgaagatcggcgtgcctttgcctcc
aggatggcagagattggagaacatgtggcccccagtgaggcggctagttctcttgaacag
gcccaagcagctgctgagcggctggggtatccagtgctggtgcgtgcagcctttgccctg
ggtggcctgggctctggctttgcctctaacagggacgagctctctgctcttgtggctccc
gcttttgcccataccagccaggtgctggtagacaagtccctgaagggatggaaggagatt
gaatatgaggtggtgagagatgcctatggcaactgtgtcacggtgtgtaacatggagaat
ttggacccattgggcatccatactggtgagtccatagtggtggctccaagccagacgctg
aatgacagggaataccagctcctgcggcagacagccatcaaggtgacgcagcaccttgga
attgttggcgagtgcaacgtgcagtatgcattgaaccccgaatccgagcagtattacatt
attgaagtgaatgccaggctctcccgcagctccgccctggccagtaaggccacaggttat
ccactggcctatgtggcagccaaactagctctgggcatccctctgcctgagctcaggaac
tccgtgacagggggaacagcagcctttgaacccagcctggattactgtgtggtgaagatc
cctcgctgggacctcagcaagttccttcgtgtcagcacaaagatcgggagctgcatgaag
agcgttggtgaagttatgggcattgggcgttcttttgaggaggccttccagaaggctctt
cgcatggtggatgagaactgtgtgggctttgatcacacagtaaagccggtcagtgatatg
gagttggagacaccaactgataagcggatctttgtggtggcagctgctctgtgggctggc
tattcggtggagcggctgtaccaactcacgcgcatcgaccgctggttcctgcaccggatg
aagaggattatagcacatgcccagctgctggaacagcatcgtggacagcctttgccccca
gacctgctgcaccaggccaagcgccttggcttctcagacaagcagattgcccttgctgtt
ctgagcacagagctggctgttcgcaagctgcgtcaggaactggggatctgcccggcggtg
aaacagattgacacagttgcagctgagtggccagcccagacaaattatttgtacctgaca
tactggggaaccacgcacgacctcacctttcgaacgccacacgtcctggtccttggctct
ggcgtctaccgtataggctccagcgttgagtttgactggtgtgctgtgggctgcatccgg
cagctccgaaagatgggatataagaccatcatggtgaactacaacccagagacagtcagc
actgattatgacatgtgtgaccgactctactttgatgagatctcttttgaggtggtgatg
gacatctatgagctagagaaccctgaaggcgtgatcctgtccatgggtgggcagctgccc
aacaacatggccatggctttgcatcggcagcagtgccgggtgctgggcacttctccggaa
gccatcgactcagctgagaaccgtttcaaattctcccggctcctagataccattggtatc
agccagcctcagtggagggagctcagtgacctagagtctgctcgccagttctgccagacg
gtggggtacccctgcgttgtgcgcccctcctatgtgctaagcggcgctgctatgaatgtg
gcctacaccgatggggacctggagcgtttcctgagcagtgcggcagccgtctctaaggag
caccctgtggtcatctctaagttcatccaggaggccaaggagattgacgtggatgctgtg
gcccgtgatggtgtggtggcagccattgccatctctgagcatgtggagaatgcaggtgta
cattcaggtgatgccacgctggtgaccccacctcaagacatcactgccaaaaccctggag
cggattaaagccatcgtgcacgctgtgggccaggagctgcaggtcacaggacccttcaat
ctgcagctcattgccaaggatgaccaactgaaagtcatcgaatgcaacgtgcgtgtctct
cgctccttccctttcgtctccaagacacttggtgtggacctagtagcactggccacccgg
gtcatcatgggggaagaagtggaacctgtggggctcatgactggctccggagtcgtgggg
gtgaaggtccctcagttctcgttttcccgtctggcgggtgctgatgtggtgttgggtgtg
gagatgaccagtaccggggaagtggctggctttggggagagccgctgcgaggcatacctc
aaggccatgctaagcactggctttaagatccccaagaagaacatcttgctgaccattggc
agctataagaacaaaagtgagctgctcccaaccgtgcggctgctggagagccttggctac
agcctttacgccagtctgggcactgctgacttctatacggagcacggcgtcaaggtaaca
gctgtggactggcactttgaggaggcagtggatggtgaatgcccaccacagcgaagcatc
ttggagcagctggctgagaatcactttgaactagtgataaacctatcgatgcgtggggct
gggggccggcgtctttcttccttcgtcaccaagggctaccgcacccggcgcctggctgct
gacttctccgtgcccctcatcattgatatcaagtgcaccaaactgtttgtggaggcacta
ggccagattgggccagcccctcctttgaaggtgcacgttgactgtatgacctcccaaaag
ctcgtgcgactacctggattaattgacatccatgtgcaccttcgggaaccagggggcaca
cacaaggaggactttgcctcaggcacggctgctgccctggctgggggcattactatggta
tgcgccatgccaaacacccggccccccatcattgatgcaccagccctggccctggcccag
aagctggcagaagctggtgcccgctgtgactttaccttatttctcggagcctcgtcagaa
aatgcagggaccctgggtgctgtggctgggtctgctgctgggttaaagctctacctcaac
gagaccttctctgagcttcggttggacaatgtggcccagtggatggagcactttgagaca
tggccatcccacctccccatcgtggcccacgcagagaggcagaatgtcgctgccatcctc
atggtggcccaactgacccagagatcagtacacatatgtcacgtggctcggaaggaggag
atcctgctgattaaagctgcaaaggcacgggggctgccagtgacttgtgaggtggcaccc
caccatctatttctgagctgcgatgacctggaacgcttggggccagggaagggggaggtc
cggccggagcttgggtcccgccaggacgtggaggccctatgggagaacatggctgtcatc
gactgcttcgcctcagaccatgcccctcacaccttggaggagaagtgtgggccccggcct
ccccctggcttcccagggctggaaaccatgctgccactgctgctgacagcagtcagtgag
ggccggctgagtctggatgacctgctgcagcggctgcaccacaatccccgccggatcttc
cacctgcctccgcaggaggacacctatgtggaggtggatctggagcacgaatggaccatc
cccagccacatgcccttctccaaggcgcactggacaccctttgaagggcagaaggtgaag
ggcaccgtccgccgtgtggtcctccgaggagaggtggcctatatcgacgggcaggtcttg
gtgcccccgggctatggacaggatgtccgcaagtggcctcagggaactgttccccagctg
gcacccccagcccctgccgccagtgagatcaccacgacgcctgagagaccccgtcgggca
gtcccagggcttcctgatggccgcttccacctgccaccccgaattcaccgagcctctgat
ccaggtctgccagctgtgttcctccgcccgggagctgggatcccacggggcagcagaacg
tgggctgaggagccaaaggaaaagtcgtctcggaaggcagctgagccagagctgatggga
actcttgatggcacctgctaccctccaccaccagtacctagacaggcgtcaccccagaac
ctggggacccctggcctgctgcacccccagacctcacccctgctgcactcattagtgggt
caacatatcctgtctgtccagcaattcaccaaggatcagatgtctcacctgttcaatgtg
gcacacacgctgcgtatgatggtacagaaggagcgaagcctcgacatactcaaggggaag
gtaatggcctccatgttctacgaggtgagcacacgcaccagcagctcctttgctgcagcc
atggcccggctggggggcgctgtgctcagcttctcagaagccacatcttcggtccagaag
ggtgaatccctggctgactcagtgcagaccatgagctgctatgccgacgtcgtcgtgctt
cggcatccccagcctggagcagtggagctggcagccaagcactgccggaggccagtgatc
aatgctggggatggggttggagagcatcccacccaggccctgctggacatcttcaccatc
cgggaggagcttgggactgtcaatggcatgacgatcacaatggtgggggacctgaagcat
ggacgcacagtgcattctctggcctgcctgctcacccagtaccgtgtcagcctgcgttat
gtggcccctcccagcctgcgcatgccatccaatgtgcgggcctttgtggcggcccgtggc
accaagcaggaggaatttgagagcattgaggaagccctgcccgacactgatgtgctctac
atgactcgaatccagaaggaacgctttgagtctagccaggagtatgaagcttgctttggc
cagttcatcctcactccccacatcatgacacgggccaagaagaagatggtggtgatgcac
ccaatgcctcgagtcaatgagatcagtgtggaggtggactcagacccccgagcagcctac
ttccgccaggccgagaatggcatgtacatacgcatggctctgttagccactgtgctgggc
cgcttctag

DBGET integrated database retrieval system