KEGG   Canis familiaris (dog): 483028Help
Entry
483028            CDS       T01007                                 

Gene name
XDH
Definition
xanthine dehydrogenase
Orthology
K00106  
xanthine dehydrogenase/oxidase [EC:1.17.1.4 1.17.3.2]
Organism
cfa  Canis familiaris (dog)
Pathway
Purine metabolism
Caffeine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Peroxisome
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:cfa00230]
Metabolism; Biosynthesis of other secondary metabolites; Caffeine metabolism [PATH:cfa00232]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - other enzymes [PATH:cfa00983]
Cellular Processes; Transport and catabolism; Peroxisome [PATH:cfa04146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
17
AA seq 1332 aa AA seqDB search
MTADELVFFVNGKKVVEKNADPETTLLAYLRRKLRLSGTKLGCGEGGCGACTVMLSKYDR
FQNKIVHFSANACLAPICSLHHVAVTTVEGIGSTKSRLHPVQERIAKSHGSQCGFCTPGI
VMSMYTLLRNQPEPTIEEIENAFQGNLCRCTGYRPILQGFRTFAKDGGCCGGSRDNPNCC
LNQKKDCSRVILSPSLFNPEEFMPLDPTQEPIFPPELLRLKDVPQKQLCFKGERVTWIQA
STLKELLDLKAQHPEAKLVVGNTEIGIEMKFKNRLFPMIVCPAWIPELNAVEHGLEGISF
GAACPLSIVEKTLHDAVNKLPAYKTEVFKGVLEQLRWFAGKQVKSVASIGGNIINASPIS
DLNPVFMASEAKLTIVSRGIKRTVRMDHTFFPGYRKTLLAPEEILLSIEIPYSREGEFFS
AFKQASRREDDIAKVTSGMRVLFHPGTAQVKELALCYGGMDDRTISALKTTRKQVENLWN
EDLLQNVCAGLAEELKLSPDAPGGMVDFRRTLTLSFFFKFYLTVLQKLERGNLENCGKLD
PTYASATLLFQKDPPANVQLFQEVPEGQSEEDMVGRPLPHLAAAMQASGEAVYCDDIPRY
ENELSLRLVTSTRAHAKIKSIDTSEAEKVPGFVCFLSFNDVPGSNKTGIFNDETIFAEDE
VTCIGHIIGAVVTDTPEHAQRAAQGVKITYEELPAIITIEDAIKNNSFYGSELKIEKGEL
TKGFSEADNVVSGEVYIGGQEHFYLETHCTIAVPKGEEGELELFASTQNTMKTQAFVANM
LGVPINRILVRVKRMGGGFGGKETRSTLVSTVVALAAYKTGRPVRCMLDRDEDMLITGGR
HPFLAKYKVGFMKTGKVVALEVEHYSNAGNTLDLSQSIMERALFHMDNCYKIPNIRGTGR
LCKTNLPSNTAFRGFGGPQGMLIAEYWMSEVAMTCGLPAEEVRRKNMYKEGDLTHFNQKL
EGFTLSRCWEECLASSQYHARKSEVDKFNEENYWKKRGLCIIPTKFGISFTLSFLNQAGA
LIHVYTDGSVLLTHGGTEMGQGLHTKMVQVASRALKIPTSKIYISETSTNTVPNTSPTAA
SVSADINGQAVYEACKTILKRLEPFKKKNPSGSWEDWVIDAYENTVSLSATGFYRTPNLG
YSFETNSGNPFHYFSYGVACSEVEIDCLTGDHKNLRTDIVMDVGSSLNPAIDIGQVEGAF
VQGLGLFTLEELHYSPEGSLQTRGPSTYKIPAFGNIPTEFRVSLLRDCPNKKAIYASKAV
GEPPLFLAASVFFAIKDAVRAARARNSDCKTKLFRLDSPATPEKIRNACVDEFTTLCVTG
IPENCKPWSVRV
NT seq 3999 nt NT seq  +upstreamnt  +downstreamnt
atgacagctgacgaattggttttcttcgtgaatggcaaaaaggtggtggagaaaaatgca
gatccagaaacaacccttttggcctacctgagaagaaaattgcggctgagtgggaccaag
ctgggctgtggagaagggggctgtggggcttgtaccgtgatgctttccaagtacgatcgt
ttccagaacaagatcgtccacttttctgccaatgcctgcctggcccccatctgctctttg
catcatgttgctgtgactaccgtggaaggaataggaagcaccaaatccaggctgcatcct
gtgcaggagagaattgccaaaagccatggctcccagtgtgggttctgcacccctggcatc
gtcatgagcatgtacacgctgctccggaaccagcctgagcccaccattgaggagatcgag
aacgccttccaaggaaacctgtgccgctgcacgggctacagacccatcctccagggcttc
cggaccttcgccaaggatggtgggtgctgtggagggagcagggacaaccccaactgctgc
ctgaaccagaagaaagactgctcacgggtcattctctcgccatctttgttcaacccagaa
gagttcatgccactggaccccacccaggaacccatcttccctccagagctgctgaggctg
aaagatgttcctcagaagcagctgtgttttaaaggcgagcgagtgacctggatccaggcc
tccaccctgaaggagctgctggacctcaaagcccagcaccccgaggccaagctagtggtg
gggaacacggagattggcattgagatgaagttcaagaacaggctgtttcctatgattgtc
tgcccagcctggatccctgagctgaatgcagtggagcacggactggagggtatctccttt
ggagctgcttgccccttgagcattgtggaaaagacactgcatgatgccgttaacaaactt
cctgcctacaaaacagaggtgttcaaaggtgtcctggagcagttgcgctggtttgctggg
aagcaggtcaagtctgtggcgtccattggagggaacatcatcaatgccagccccatctct
gacctcaatcctgtgttcatggccagtgaggccaagctgaccatcgtgtccagaggcatc
aagagaacagttcggatggaccacaccttcttccctggctacaggaagaccctactagcc
ccggaggagatcctgctttccatcgagatcccctacagcagggagggtgagtttttctca
gcattcaagcaggcctctcggagggaagatgacatagccaaggtgaccagtggcatgaga
gtcctgttccatccaggaaccgcacaggtaaaggagctggccctttgctatggcggaatg
gatgacagaaccatctcagctctcaagaccacacggaagcaggtggaaaatttatggaat
gaggatctgctgcagaacgtgtgtgcaggcctggcagaggagctgaagctgtcccccgat
gcccctggcggcatggtggactttcggcggaccctcaccctcagcttcttcttcaaattc
tacctgacagtgcttcagaaattagagagagggaacttagaaaattgtgggaagctggac
cccacctatgccagtgccaccttactctttcagaaagaccctccagccaacgtccagctc
ttccaagaggtgcctgagggtcagtctgaagaggacatggtgggccggcccctgccccac
ctggctgcggccatgcaggcctccggggaggctgtgtactgtgacgacatccctcgctac
gagaacgagctgtccctccgactggtcaccagcacccgggcccatgccaagatcaagtcc
atagatacttcagaagctgagaaggtgccagggttcgtttgctttctctcttttaatgat
gttcctgggagtaataaaactggaatttttaacgatgaaacaatctttgcagaggatgag
gtgacttgtattgggcacatcattggtgctgtggtcaccgacactccagaacatgcacag
agagctgctcagggggtgaaaatcacctatgaagaacttccagccattattacaattgag
gatgctataaaaaacaattccttttatgggtctgagctgaagatcgagaagggagaactc
acgaaggggttttcagaagcagacaacgttgtttcaggcgaagtgtacataggtgggcaa
gagcacttctacctggagactcactgcaccatcgccgtcccgaaaggtgaggaaggggag
ttggagctctttgcgtctacacagaacaccatgaagacccaggccttcgtggcaaacatg
ttgggggttccaataaaccggattttggtccgagtgaagagaatgggaggaggctttgga
gggaaagagacccggagcaccctggtgtccacggtagtagccctggctgcatacaagact
ggccgccctgtgcgctgcatgctggatcgtgatgaggacatgctgataactggtggcaga
catcccttcttagccaaatacaaggttggcttcatgaagactgggaaggtggtggctctg
gaggtggagcactacagcaatgctgggaataccctggatctctcccagagtataatggaa
cgagccctattccacatggacaactgctataaaatacccaatatccggggcactgggcgg
ctctgcaagaccaacctgccctccaacacggccttccggggctttgggggaccccagggc
atgctcattgctgagtattggatgagtgaagtcgcaatgacctgtgggctgcctgcagag
gaagtgcggaggaaaaacatgtataaggaaggggacctgacacacttcaaccagaagctt
gaggggttcaccttgtccaggtgctgggaggaatgcctagcaagctctcagtatcacgcc
cggaagagtgaggttgacaagttcaatgaggagaattattggaagaagagaggattgtgt
ataattcctaccaagtttggaataagcttcactctttcttttctgaatcaggcaggagcc
ctgattcatgtgtacacagatggctctgtgctgctgacccatgggggcactgagatgggc
caaggcctacacaccaagatggtccaggtggccagcagagctctgaaaatccctacctct
aagatttacatcagtgagacaagcacgaacactgtgcccaacacctctcccacggccgcc
tccgtcagcgctgacatcaatggacaggctgtctatgaagcttgtaagaccatcctgaaa
agactggagcccttcaagaaaaagaatcctagtggctcctgggaagattgggtcatagac
gcctacgagaacacagtgagcttgtctgcgactgggttttataggacacccaaccttggc
tacagctttgagactaactcggggaatcccttccactacttctcctatggggtggcttgc
tctgaagtggagatcgattgcttaaccggggatcacaaaaacctccgtaccgacattgtc
atggatgttggttccagtctgaaccctgccattgatattggacaggtggaaggagcattt
gtgcagggccttggcctcttcaccctggaggagctgcactactccccagaggggagcctg
cagacccgtggccccagcacctataagatccctgcgtttggcaacatccccactgagttc
agagtgtccctgctccgcgactgccccaacaagaaggccatctatgcgtccaaggccgtc
ggggagccgcccctcttcctggcagcctctgtcttctttgccatcaaggacgccgtccgt
gcagctcgtgctaggaactcagattgtaaaacgaagcttttccggctagacagccctgca
accccagaaaagatccgcaatgcctgcgtggacgagttcaccacactgtgtgtcactggc
ataccagaaaactgtaagccctggtcggtgagggtctga

DBGET integrated database retrieval system