KEGG   Canis familiaris (dog): 483028Help
Entry
483028            CDS       T01007                                 

Gene name
XDH
Definition
xanthine dehydrogenase
Orthology
K00106  
xanthine dehydrogenase/oxidase [EC:1.17.1.4 1.17.3.2]
Organism
cfa  Canis familiaris (dog)
Pathway
Purine metabolism
Caffeine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Peroxisome
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    483028 (XDH)
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    483028 (XDH)
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    483028 (XDH)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    483028 (XDH)
Enzymes [BR:cfa01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     483028 (XDH)
   1.17.3  With oxygen as acceptor
    1.17.3.2  xanthine oxidase
     483028 (XDH)
Exosome [BR:cfa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   483028 (XDH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
17
AA seq 1332 aa AA seqDB search
MTADELVFFVNGKKVVEKNADPETTLLAYLRRKLRLSGTKLGCGEGGCGACTVMLSKYDR
FQNKIVHFSANACLAPICSLHHVAVTTVEGIGSTKSRLHPVQERIAKSHGSQCGFCTPGI
VMSMYTLLRNQPEPTIEEIENAFQGNLCRCTGYRPILQGFRTFAKDGGCCGGSRDNPNCC
LNQKKDCSRVILSPSLFNPEEFMPLDPTQEPIFPPELLRLKDVPQKQLCFKGERVTWIQA
STLKELLDLKAQHPEAKLVVGNTEIGIEMKFKNRLFPMIVCPAWIPELNAVEHGLEGISF
GAACPLSIVEKTLHDAVNKLPAYKTEVFKGVLEQLRWFAGKQVKSVASIGGNIINASPIS
DLNPVFMASEAKLTIVSRGIKRTVRMDHTFFPGYRKTLLAPEEILLSIEIPYSREGEFFS
AFKQASRREDDIAKVTSGMRVLFHPGTAQVKELALCYGGMDDRTISALKTTRKQVENLWN
EDLLQNVCAGLAEELKLSPDAPGGMVDFRRTLTLSFFFKFYLTVLQKLERGNLENCGKLD
PTYASATLLFQKDPPANVQLFQEVPEGQSEEDMVGRPLPHLAAAMQASGEAVYCDDIPRY
ENELSLRLVTSTRAHAKIKSIDTSEAEKVPGFVCFLSFNDVPGSNKTGIFNDETIFAEDE
VTCIGHIIGAVVTDTPEHAQRAAQGVKITYEELPAIITIEDAIKNNSFYGSELKIEKGEL
TKGFSEADNVVSGEVYIGGQEHFYLETHCTIAVPKGEEGELELFASTQNTMKTQAFVANM
LGVPINRILVRVKRMGGGFGGKETRSTLVSTVVALAAYKTGRPVRCMLDRDEDMLITGGR
HPFLAKYKVGFMKTGKVVALEVEHYSNAGNTLDLSQSIMERALFHMDNCYKIPNIRGTGR
LCKTNLPSNTAFRGFGGPQGMLIAEYWMSEVAMTCGLPAEEVRRKNMYKEGDLTHFNQKL
EGFTLSRCWEECLASSQYHARKSEVDKFNEENYWKKRGLCIIPTKFGISFTLSFLNQAGA
LIHVYTDGSVLLTHGGTEMGQGLHTKMVQVASRALKIPTSKIYISETSTNTVPNTSPTAA
SVSADINGQAVYEACKTILKRLEPFKKKNPSGSWEDWVIDAYENTVSLSATGFYRTPNLG
YSFETNSGNPFHYFSYGVACSEVEIDCLTGDHKNLRTDIVMDVGSSLNPAIDIGQVEGAF
VQGLGLFTLEELHYSPEGSLQTRGPSTYKIPAFGNIPTEFRVSLLRDCPNKKAIYASKAV
GEPPLFLAASVFFAIKDAVRAARARNSDCKTKLFRLDSPATPEKIRNACVDEFTTLCVTG
IPENCKPWSVRV
NT seq 3999 nt NT seq  +upstreamnt  +downstreamnt
atgacagctgacgaattggttttcttcgtgaatggcaaaaaggtggtggagaaaaatgca
gatccagaaacaacccttttggcctacctgagaagaaaattgcggctgagtgggaccaag
ctgggctgtggagaagggggctgtggggcttgtaccgtgatgctttccaagtacgatcgt
ttccagaacaagatcgtccacttttctgccaatgcctgcctggcccccatctgctctttg
catcatgttgctgtgactaccgtggaaggaataggaagcaccaaatccaggctgcatcct
gtgcaggagagaattgccaaaagccatggctcccagtgtgggttctgcacccctggcatc
gtcatgagcatgtacacgctgctccggaaccagcctgagcccaccattgaggagatcgag
aacgccttccaaggaaacctgtgccgctgcacgggctacagacccatcctccagggcttc
cggaccttcgccaaggatggtgggtgctgtggagggagcagggacaaccccaactgctgc
ctgaaccagaagaaagactgctcacgggtcattctctcgccatctttgttcaacccagaa
gagttcatgccactggaccccacccaggaacccatcttccctccagagctgctgaggctg
aaagatgttcctcagaagcagctgtgttttaaaggcgagcgagtgacctggatccaggcc
tccaccctgaaggagctgctggacctcaaagcccagcaccccgaggccaagctagtggtg
gggaacacggagattggcattgagatgaagttcaagaacaggctgtttcctatgattgtc
tgcccagcctggatccctgagctgaatgcagtggagcacggactggagggtatctccttt
ggagctgcttgccccttgagcattgtggaaaagacactgcatgatgccgttaacaaactt
cctgcctacaaaacagaggtgttcaaaggtgtcctggagcagttgcgctggtttgctggg
aagcaggtcaagtctgtggcgtccattggagggaacatcatcaatgccagccccatctct
gacctcaatcctgtgttcatggccagtgaggccaagctgaccatcgtgtccagaggcatc
aagagaacagttcggatggaccacaccttcttccctggctacaggaagaccctactagcc
ccggaggagatcctgctttccatcgagatcccctacagcagggagggtgagtttttctca
gcattcaagcaggcctctcggagggaagatgacatagccaaggtgaccagtggcatgaga
gtcctgttccatccaggaaccgcacaggtaaaggagctggccctttgctatggcggaatg
gatgacagaaccatctcagctctcaagaccacacggaagcaggtggaaaatttatggaat
gaggatctgctgcagaacgtgtgtgcaggcctggcagaggagctgaagctgtcccccgat
gcccctggcggcatggtggactttcggcggaccctcaccctcagcttcttcttcaaattc
tacctgacagtgcttcagaaattagagagagggaacttagaaaattgtgggaagctggac
cccacctatgccagtgccaccttactctttcagaaagaccctccagccaacgtccagctc
ttccaagaggtgcctgagggtcagtctgaagaggacatggtgggccggcccctgccccac
ctggctgcggccatgcaggcctccggggaggctgtgtactgtgacgacatccctcgctac
gagaacgagctgtccctccgactggtcaccagcacccgggcccatgccaagatcaagtcc
atagatacttcagaagctgagaaggtgccagggttcgtttgctttctctcttttaatgat
gttcctgggagtaataaaactggaatttttaacgatgaaacaatctttgcagaggatgag
gtgacttgtattgggcacatcattggtgctgtggtcaccgacactccagaacatgcacag
agagctgctcagggggtgaaaatcacctatgaagaacttccagccattattacaattgag
gatgctataaaaaacaattccttttatgggtctgagctgaagatcgagaagggagaactc
acgaaggggttttcagaagcagacaacgttgtttcaggcgaagtgtacataggtgggcaa
gagcacttctacctggagactcactgcaccatcgccgtcccgaaaggtgaggaaggggag
ttggagctctttgcgtctacacagaacaccatgaagacccaggccttcgtggcaaacatg
ttgggggttccaataaaccggattttggtccgagtgaagagaatgggaggaggctttgga
gggaaagagacccggagcaccctggtgtccacggtagtagccctggctgcatacaagact
ggccgccctgtgcgctgcatgctggatcgtgatgaggacatgctgataactggtggcaga
catcccttcttagccaaatacaaggttggcttcatgaagactgggaaggtggtggctctg
gaggtggagcactacagcaatgctgggaataccctggatctctcccagagtataatggaa
cgagccctattccacatggacaactgctataaaatacccaatatccggggcactgggcgg
ctctgcaagaccaacctgccctccaacacggccttccggggctttgggggaccccagggc
atgctcattgctgagtattggatgagtgaagtcgcaatgacctgtgggctgcctgcagag
gaagtgcggaggaaaaacatgtataaggaaggggacctgacacacttcaaccagaagctt
gaggggttcaccttgtccaggtgctgggaggaatgcctagcaagctctcagtatcacgcc
cggaagagtgaggttgacaagttcaatgaggagaattattggaagaagagaggattgtgt
ataattcctaccaagtttggaataagcttcactctttcttttctgaatcaggcaggagcc
ctgattcatgtgtacacagatggctctgtgctgctgacccatgggggcactgagatgggc
caaggcctacacaccaagatggtccaggtggccagcagagctctgaaaatccctacctct
aagatttacatcagtgagacaagcacgaacactgtgcccaacacctctcccacggccgcc
tccgtcagcgctgacatcaatggacaggctgtctatgaagcttgtaagaccatcctgaaa
agactggagcccttcaagaaaaagaatcctagtggctcctgggaagattgggtcatagac
gcctacgagaacacagtgagcttgtctgcgactgggttttataggacacccaaccttggc
tacagctttgagactaactcggggaatcccttccactacttctcctatggggtggcttgc
tctgaagtggagatcgattgcttaaccggggatcacaaaaacctccgtaccgacattgtc
atggatgttggttccagtctgaaccctgccattgatattggacaggtggaaggagcattt
gtgcagggccttggcctcttcaccctggaggagctgcactactccccagaggggagcctg
cagacccgtggccccagcacctataagatccctgcgtttggcaacatccccactgagttc
agagtgtccctgctccgcgactgccccaacaagaaggccatctatgcgtccaaggccgtc
ggggagccgcccctcttcctggcagcctctgtcttctttgccatcaaggacgccgtccgt
gcagctcgtgctaggaactcagattgtaaaacgaagcttttccggctagacagccctgca
accccagaaaagatccgcaatgcctgcgtggacgagttcaccacactgtgtgtcactggc
ataccagaaaactgtaagccctggtcggtgagggtctga

DBGET integrated database retrieval system