KEGG   Canis familiaris (dog): 483038Help
Entry
483038            CDS       T01007                                 

Gene name
CYP1B1
Definition
cytochrome P450, family 1, subfamily B, polypeptide 1 (EC:1.14.14.1)
Orthology
K07410  
cytochrome P450, family 1, subfamily B, polypeptide 1 [EC:1.14.14.1]
Organism
cfa  Canis familiaris (dog)
Pathway
Steroid hormone biosynthesis
Tryptophan metabolism
Metabolism of xenobiotics by cytochrome P450
Ovarian steroidogenesis
Chemical carcinogenesis
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    483038 (CYP1B1)
  Amino acid metabolism
   00380 Tryptophan metabolism
    483038 (CYP1B1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    483038 (CYP1B1)
 Organismal Systems
  Endocrine system
   04913 Ovarian Steroidogenesis
    483038 (CYP1B1)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    483038 (CYP1B1)
   05204 Chemical carcinogenesis
    483038 (CYP1B1)
Enzymes [BR:cfa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     483038 (CYP1B1)
Cytochrome P450 [BR:cfa00199]
 Cytochrome P450, animal type
  CYP1 family
   483038 (CYP1B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
17
AA seq 543 aa AA seqDB search
MATSLGPDAPLQPSALSAQQTTLLLLLSVLAAVHAGQWLLRQRRRQPGSAPPGPFAWPLI
GNAAAMGPAPHLSFARLARRYGDVFQIRLGSCPVVVLNGERAIRQALVQQGAAFADRPRF
ASFRVVSGGRSLAFGQYSPRWKVQRRAAHSTMRAFSTRQPRSRRVLEGHVLAETRELVAL
LARGSAGGAFLDPRPLTVVAVANVMSAVCFGCRYSHDDAEFRELLSHNEEFGRTVGAGSL
VDVLPWLQRFPNPVRTAFREFEQLNRNFSNFVLRKFLRHRESLQPGAAPRDMMDAFILSA
GTEAAEGSGDGGARLDMEYVPATVTDIFGASQDTLSIALQWLLILFTRYPQVQARVQEEL
DQVVGRNRLPCLDDQPNLPYTMAFLYEGMRFSSFVPVTIPHATTTSACVLGYHIPKDTVV
FVNQWSVNHDPVKWPNPEDFDPARFLDKDGFIDKDLASSVMIFSVGKRRCIGEELSKMQL
FLFISILAHQCNFKANPDEPSKMDFNYGLTIKPKAFSINVTLRESMELLDSAVQKLQAEE
DCQ
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atggccaccagcctcgggcccgacgctcccctgcagccgagcgcgctgtccgcccagcag
accacgctcctgctgctgctgtcggtgctggccgcggtgcacgcgggccagtggctgctg
aggcagcggcggcggcagccggggtccgcgccgcccggcccgtttgcgtggccgctgatc
ggaaacgccgcggcgatgggccccgcgccgcacctctcgttcgcgcgcctggcgcggcgc
tacggcgacgtgttccagatccgcctgggcagctgcccggtggtggtgctgaacggcgag
cgcgccatccgccaggcgctggtgcagcagggcgccgccttcgccgaccggccgcgcttc
gcttcctttcgcgtggtgtcgggcggccgcagcctggctttcggccagtactccccgcgc
tggaaggtgcagcggcgcgcggcgcacagcaccatgcgggccttctccacgcgccagccg
cgcagccgccgcgtcctcgagggccacgtgctggccgagacgcgcgagctggtggcgctg
ctggcgcgcggcagcgcgggcggcgccttcctggacccgcggccgctgaccgtggtggcc
gtggccaacgtcatgagcgccgtgtgcttcggctgccgctacagccacgatgacgccgag
ttccgcgagctgctcagccacaacgaggagttcgggcgcacggtgggcgcgggcagcttg
gtggacgtgctgccctggctgcagcgcttccccaaccccgtgcgcaccgccttccgcgag
ttcgagcagctcaaccgcaacttcagcaactttgtcctgcgcaagttcctgcggcaccgc
gaaagcctgcagcccggggccgccccccgcgacatgatggacgccttcatcctctcggcg
gggaccgaggcggcggagggctcgggcgacggcggcgcgcggttggacatggagtacgtg
ccggccactgtcaccgacatcttcggcgccagccaggacacgctctccatcgcgctgcag
tggctgctcatccttttcaccaggtatccacaagtgcaggctcgggtccaggaagaattg
gatcaagtcgtgggtagaaaccggctgccctgcctggatgaccagcccaacctgccctac
accatggcctttctttacgaaggcatgcgtttctccagctttgtgcccgtcaccattcct
catgccaccaccaccagtgcctgtgtcttaggctaccacattcccaaggacacagtggtt
tttgttaaccagtggtctgtgaatcatgacccagtgaagtggcctaacccagaggacttt
gatccagcccggttcttggacaaagacggcttcattgacaaggacctggccagcagcgtg
atgattttttcagtgggcaaacggcgatgcattggggaagagctttccaagatgcagctg
tttctcttcatttccatcctggctcaccagtgcaatttcaaggccaatccagacgaaccc
tcaaaaatggattttaattacggtctgaccattaaacccaaggcatttagtatcaacgtc
actctcagagagtccatggagctccttgatagtgccgtccaaaagttacaagctgaggaa
gactgccagtga

DBGET integrated database retrieval system