KEGG   Canis familiaris (dog): 483039Help
Entry
483039            CDS       T01007                                 

Gene name
GALM
Definition
galactose mutarotase (aldose 1-epimerase)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
cfa  Canis familiaris (dog)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    483039 (GALM)
   00052 Galactose metabolism
    483039 (GALM)
Enzymes [BR:cfa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     483039 (GALM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
17
AA seq 288 aa AA seqDB search
MTPGKQQCLCYLQKQPYFGAVVGRVANRIAKGTFTLDGKEYKLAINNGPNSLHGGIRGFD
KVLWTPEVLSNGVQFSRVSPDGEEGYPGELKVWVTYTLDGGELKINYRAQASQTTPVNLT
NHSYFNLAGQGSPNIYDHEVTIDADAFLPVDETLIPTGEVAPVQGTAFDLRKPVELGKHL
QEFHINGFDHNFCLKGSKEKHFCARVHHAGSGRVLEVYTTQPGIQFYTGNFLDGTLKGKS
GAVYPKHSGFCLETQNWPDAVHQPNFPPVLLRPGEEYDHTTWLKFSVA
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgacacctgggaaacagcagtgtctttgctacctccaaaagcagccctactttggagca
gtggttggcagggtggcgaaccgaattgccaaagggacattcacattggacgggaaggag
tacaagctggccattaacaatgggcccaacagtctgcatggaggaatccgagggttcgac
aaggtcctctggacccctgaagtgctgtcaaatggcgtccagttctcaagggtcagtcca
gatggtgaggaaggttaccctggagagttgaaagtctgggtgacatacacgctggatggt
ggggagcttaagatcaactaccgagcacaggccagtcagaccacaccagtcaatctgacc
aaccattcttatttcaaccttgcaggccagggttctccaaacatatatgaccatgaagtc
actatagatgctgatgcctttttgcctgtggatgaaaccctgattcctacaggagaagtt
gctccagtacaaggaacagcgtttgacctgaggaagccagtcgagcttggaaaacacctg
caggagttccatatcaatggctttgaccacaatttctgtctgaagggatctaaagaaaag
cacttttgtgcacgggtccatcatgctggaagtggccgtgtcctggaagtgtacactacc
cagcctgggatccagttttacacaggcaacttcctggatggcacgctgaagggcaagagt
ggagcagtctatcccaagcactccggtttctgtctcgagacccagaactggcctgatgca
gtccatcagcccaacttccctcctgtgctgctgaggcctggggaggagtatgaccacacc
acttggctcaagttttctgtggcttaa

DBGET integrated database retrieval system