KEGG   Canis familiaris (dog): 483042Help
Entry
483042            CDS       T01007                                 

Gene name
SOS1
Definition
(RefSeq) SOS Ras/Rac guanine nucleotide exchange factor 1
  KO
K03099  son of sevenless
Organism
cfa  Canis familiaris (dog)
Pathway
cfa01521  EGFR tyrosine kinase inhibitor resistance
cfa01522  Endocrine resistance
cfa04010  MAPK signaling pathway
cfa04012  ErbB signaling pathway
cfa04014  Ras signaling pathway
cfa04062  Chemokine signaling pathway
cfa04068  FoxO signaling pathway
cfa04072  Phospholipase D signaling pathway
cfa04150  mTOR signaling pathway
cfa04151  PI3K-Akt signaling pathway
cfa04510  Focal adhesion
cfa04540  Gap junction
cfa04630  Jak-STAT signaling pathway
cfa04650  Natural killer cell mediated cytotoxicity
cfa04660  T cell receptor signaling pathway
cfa04662  B cell receptor signaling pathway
cfa04664  Fc epsilon RI signaling pathway
cfa04714  Thermogenesis
cfa04722  Neurotrophin signaling pathway
cfa04810  Regulation of actin cytoskeleton
cfa04910  Insulin signaling pathway
cfa04912  GnRH signaling pathway
cfa04915  Estrogen signaling pathway
cfa04917  Prolactin signaling pathway
cfa04926  Relaxin signaling pathway
cfa05034  Alcoholism
cfa05160  Hepatitis C
cfa05165  Human papillomavirus infection
cfa05200  Pathways in cancer
cfa05205  Proteoglycans in cancer
cfa05206  MicroRNAs in cancer
cfa05210  Colorectal cancer
cfa05211  Renal cell carcinoma
cfa05213  Endometrial cancer
cfa05214  Glioma
cfa05215  Prostate cancer
cfa05220  Chronic myeloid leukemia
cfa05221  Acute myeloid leukemia
cfa05223  Non-small cell lung cancer
cfa05224  Breast cancer
cfa05225  Hepatocellular carcinoma
cfa05226  Gastric cancer
cfa05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    483042 (SOS1)
   04010 MAPK signaling pathway
    483042 (SOS1)
   04012 ErbB signaling pathway
    483042 (SOS1)
   04630 Jak-STAT signaling pathway
    483042 (SOS1)
   04068 FoxO signaling pathway
    483042 (SOS1)
   04072 Phospholipase D signaling pathway
    483042 (SOS1)
   04151 PI3K-Akt signaling pathway
    483042 (SOS1)
   04150 mTOR signaling pathway
    483042 (SOS1)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    483042 (SOS1)
   04540 Gap junction
    483042 (SOS1)
  Cell motility
   04810 Regulation of actin cytoskeleton
    483042 (SOS1)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    483042 (SOS1)
   04660 T cell receptor signaling pathway
    483042 (SOS1)
   04662 B cell receptor signaling pathway
    483042 (SOS1)
   04664 Fc epsilon RI signaling pathway
    483042 (SOS1)
   04062 Chemokine signaling pathway
    483042 (SOS1)
  Endocrine system
   04910 Insulin signaling pathway
    483042 (SOS1)
   04912 GnRH signaling pathway
    483042 (SOS1)
   04915 Estrogen signaling pathway
    483042 (SOS1)
   04917 Prolactin signaling pathway
    483042 (SOS1)
   04926 Relaxin signaling pathway
    483042 (SOS1)
  Nervous system
   04722 Neurotrophin signaling pathway
    483042 (SOS1)
  Environmental adaptation
   04714 Thermogenesis
    483042 (SOS1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    483042 (SOS1)
   05231 Choline metabolism in cancer
    483042 (SOS1)
   05206 MicroRNAs in cancer
    483042 (SOS1)
   05205 Proteoglycans in cancer
    483042 (SOS1)
   05210 Colorectal cancer
    483042 (SOS1)
   05225 Hepatocellular carcinoma
    483042 (SOS1)
   05226 Gastric cancer
    483042 (SOS1)
   05214 Glioma
    483042 (SOS1)
   05221 Acute myeloid leukemia
    483042 (SOS1)
   05220 Chronic myeloid leukemia
    483042 (SOS1)
   05211 Renal cell carcinoma
    483042 (SOS1)
   05215 Prostate cancer
    483042 (SOS1)
   05213 Endometrial cancer
    483042 (SOS1)
   05224 Breast cancer
    483042 (SOS1)
   05223 Non-small cell lung cancer
    483042 (SOS1)
  Substance dependence
   05034 Alcoholism
    483042 (SOS1)
  Infectious diseases
   05160 Hepatitis C
    483042 (SOS1)
   05165 Human papillomavirus infection
    483042 (SOS1)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    483042 (SOS1)
   01522 Endocrine resistance
    483042 (SOS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RasGEF RasGEF_N RhoGEF Histone PH PH_10 IQ_SEC7_PH PH_13
Motif
Other DBs
NCBI-GeneID: 483042
NCBI-ProteinID: XP_013975714
Ensembl: ENSCAFG00000006340
Position
17
AA seq 1358 aa AA seqDB search
MQICNDSPIPVGSSRAKLARLTVRILNPGRGGGGGPERPEREGGARTWKRVSSSVQGQVH
PTLESSDDALQYVEELILQLLNMLCQAQPRSASDVEERVQKSFPHPIDKWAIADAQSAIE
KRKRRNPLSLPVEKIHPLLKEVLGYKIDHQVSVYIVAVLEYISADILKLVGNYVRNIRHY
EITKQDIKVAMCADKVLMDMFHQDVEDINILSLTDEEPSTSGEQTYYDLVKAFMAEIRQY
IRELNLIIKVFREPFVSNSKLFSANDVENIFSRIVDIHELSVKLLGHIEDTVEMTDEGSP
HPLVGSCFEDLAEELAFDPYESYARDILRPGFHDRFLSQLSKPGAALYLQSIGEGFKEAV
QYVLPRLLLAPVYHCLHYFELLKQLEEKSEDQEDKECLKQAITALLNVQSGMEKICSKSL
AKRRLSESACRFYSQQMKGKQLAIKKMNEIQKNIDGWEGKDIGQCCNEFIMEGTLTRVGA
KHERHIFLFDGLMICCKSNHGQPRLPGASNAEYRLKEKFFMRKVQINDKDDTSEYKHAFE
IILKDENSVIFSAKSAEEKNNWMAALISLQYRSTLERMLDVTMLQEEKEEQMRLPSADVY
RFAEPDSEENIIFEENMQPKAGIPIIKAGTVIKLIERLTYHMYADPNFVRTFLTTYRSFC
KPQELLSLIIERFEIPEPEPTEADRIAIENGDQPLSAELKRFRKEYIQPVQLRVLNVCRH
WVEHHFYDFERDADLLQRMEEFIGTVRGKAMKKWVESITKIIQRKKIARDNGPGHNITFQ
SSPPTVEWHISRPGHIETFDLLTLHPIEIARQLTLLESDLYRAVQPSELVGSVWTKEDKE
INSPNLLKMIRHTTNLTLWFEKCIVETENLEERVAVVSRIIEILQVFQELNNFNGVLEVV
SAMNSSPVYRLDHTFEQIPSRQKKILEEAHELSEDHYKKYLAKLRSINPPCVPFFGIYLT
NILKTEEGNPEVLKRHGKELINFSKRRKVAEITGEIQQYQNQPYCLRVESDIKRFFENLN
PMGNSMEKEFTDYLFNKSLEIEPRNPKPLPRFPKKYSYPLKSPGVRPSNPRPGTMRHPTP
LQQEPRKISYSRIPESETESTASAPNSPRTPLTPPPASGASSTTDVCSVFDSDHSSPFHS
SSDTVFIQVSLPHGPRSASVSSISLTKGTDEVPVPPPVPPRRRPESAPAESSPSKIMSKH
LDSPPAIPPRQPTSKAYSPRYSISDRTSISDPPESPPLLPPREPVRTPDVFSSSPLHLQP
PPLGKKSDHGNAFFPNSPSPFTPPPPQTPSPHGTRRHLPSPPLTQEADLPSVTGPPVPPR
QSTSQHIPKLPPKTYKREHTHPSVHRDGPPLLENAHSS
NT seq 4077 nt NT seq  +upstreamnt  +downstreamnt
atgcagatctgcaatgactctcccatcccagtggggagttccagagcaaagcttgcccgc
ttaacggtaagaatcctgaacccggggcggggcgggggggggggtccggaaagacctgag
agagaagggggcgcaagaacgtggaaaagagttagttcctcggtccagggacaagttcat
ccgactcttgagtctagtgacgatgctcttcaatatgttgaagaattaattttgcagtta
ttaaatatgctatgccaagctcagccccgaagtgcttcagatgtagaggaacgtgttcaa
aaaagtttccctcatccaattgataagtgggcaatagctgatgcccaatcggctattgaa
aagaggaagcgaagaaaccctttatctctcccagtagaaaaaattcatcctttattaaag
gaggtcctaggttataaaattgaccaccaagtttctgtttacatagtagcagtattagaa
tacatttctgcagacattttaaagctggtggggaattatgtacggaatatacggcattat
gaaattacaaaacaagatattaaagtggcaatgtgtgctgataaggtattaatggacatg
tttcatcaagatgtagaagatataaatatattatctttgactgatgaagagccttccacc
tcaggagagcaaacttattatgatttggtaaaagcatttatggcagaaattcgacagtac
ataagggaactaaatttaattataaaagtttttagagagccctttgtctccaattcaaaa
ttgttttcagctaatgatgtagaaaatatatttagtcgtatagtagatatacatgaactt
agtgtaaagttactgggccatatagaagatactgtggaaatgactgatgaagggagcccc
catcccttagtaggaagctgctttgaagacttagcagaggaactggcatttgatccatat
gaatcatatgctcgagatattttacggcctggttttcatgatcgtttccttagtcagtta
tcaaagcctggagcagcactctatttacagtcaataggcgaaggtttcaaagaagctgtt
cagtatgttttacccaggctacttctagcccctgtttaccactgtctacattactttgaa
cttttgaagcagttagaagaaaagagtgaagatcaagaggacaaggagtgtttgaaacaa
gcaataacagctttgcttaatgttcagagtggtatggaaaaaatatgttctaaaagtctt
gcaaaacgaagactgagtgaatctgcatgtcggttttatagtcagcaaatgaaggggaaa
caactagcaatcaagaaaatgaacgagattcaaaagaatattgatggttgggagggaaaa
gacattggacaatgttgcaatgaatttataatggaaggaactcttacacgtgtaggagcc
aaacatgagagacacatatttctctttgatggcttaatgatttgctgtaaatcaaatcat
gggcagccaagacttcctggtgctagcaatgcagaatatcgtcttaaagaaaagtttttc
atgagaaaggtacaaattaatgacaaagatgacaccagtgagtacaagcatgcttttgaa
ataattttaaaagatgaaaatagtgttatattttctgccaagtcagctgaagagaaaaac
aattggatggcagcattgatatctttacagtaccggagtacactggaaaggatgcttgat
gtgacgatgctacaggaagagaaggaggagcagatgaggctccctagtgccgatgtttat
agatttgcagagcctgactctgaagagaatataatatttgaagaaaacatgcagcccaag
gctggaattccaattatcaaagcaggaactgttattaaacttatagagaggctcacgtac
catatgtacgcagatcccaattttgttcggacatttcttacaacatacagatccttttgt
aaacctcaagaactactgagtcttataatagaaaggtttgaaattccagagcctgagcca
acagaagctgatcgcatagctatagagaatggagatcagcccttgagtgcagaactaaaa
aggtttagaaaagaatacatacagcctgtacaactgcgagtattaaatgtatgtcggcat
tgggtggagcaccacttctatgattttgaaagagatgcagatcttttgcagcgaatggaa
gaatttattggaacagtgagaggtaaagcaatgaaaaaatgggttgaatccatcactaaa
ataatccaaaggaaaaaaattgcaagagacaatggaccaggtcataatattacatttcag
agttcacctcccacagtcgagtggcatataagcaggcctgggcacatagagacttttgac
ctgctcaccttacacccaatagaaattgctcgacaactcactttacttgaatcagatctg
tatcgagctgtacagccatcagaattagttggaagtgtgtggacaaaagaagacaaagaa
attaattctcccaatcttctaaaaatgatccggcacaccactaatctcactctgtggttt
gagaaatgtattgtagaaactgaaaacttagaagaaagagtagctgtggtgagtcgaata
attgagattctacaagtctttcaagagctgaacaacttcaatggtgttcttgaggttgtc
agtgctatgaactcatcacctgtttacagactagaccacacatttgagcaaataccaagt
cgccaaaagaaaattttagaagaagctcatgaattaagtgaagatcactataagaaatat
ttggcaaaactcaggtctattaatccaccatgtgtgcctttctttggaatttatctaact
aatatcttgaaaacagaagaaggcaaccctgaggtcctaaaaaggcatggaaaagagctt
ataaactttagcaaaaggaggaaagtagcagaaataacaggagagatccagcagtaccaa
aatcagccttattgtttacgagtagaatcagatatcaaaaggttttttgaaaatttgaat
ccaatgggaaatagcatggaaaaagaatttacagattatcttttcaacaaatccctagag
atagaaccacgaaaccctaagcctctgccaagatttccaaaaaaatatagctatccccta
aaatctcctggtgttcgtccatcaaacccaagaccaggtaccatgagacatcctacacct
ctgcagcaggagccaaggaaaattagttatagtagaatccctgaaagtgaaacagaaagt
acagcatctgcaccaaattctccaagaacaccgttaacacctcctcctgcttctggtgct
tctagtaccacagatgtttgcagcgtttttgattccgaccattcgagcccttttcactca
agcagcgataccgtctttatccaagtttcactgccccatggcccaagatctgcttcagta
tcatctataagtttaaccaagggcactgatgaagtacctgtcccccctcctgttcctcca
cgaagaaggccggaatctgcccccgccgaatcttcaccgtctaagattatgtctaagcat
ttggacagccccccagcaattcctcctaggcagcccacatcaaaagcctattcaccgcga
tattcaatatcagaccggacctctatatcagaccctcctgagagccctcccttattacca
ccacgagaacctgtgaggacacctgatgttttctccagctcaccactacatctccagcct
ccccctctgggcaaaaaaagtgatcatggcaatgccttcttcccaaacagcccttcccct
tttacaccacctcctcctcaaacaccttctccccatggcacgagaaggcatctgccatca
ccaccattgacacaagaagcggaccttccttcagtcactgggccgcctgttcctccacga
caaagcacttcccaacatatccctaaactccctccgaaaacttataaaagggagcacaca
cacccatctgtgcacagagatggaccacccctgttggagaatgcccattcttcctga

DBGET integrated database retrieval system