KEGG   Canis familiaris (dog): 483369Help
Entry
483369            CDS       T01007                                 

Gene name
P4HB
Definition
(RefSeq) prolyl 4-hydroxylase subunit beta
  KO
K09580  protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    483369 (P4HB)
Enzymes [BR:cfa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     483369 (P4HB)
Chaperones and folding catalysts [BR:cfa03110]
 Protein folding catalysts
  Protein disulfide isomerase
   483369 (P4HB)
Membrane trafficking [BR:cfa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    483369 (P4HB)
Exosome [BR:cfa04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   483369 (P4HB)
  Exosomal proteins of colorectal cancer cells
   483369 (P4HB)
  Exosomal proteins of bladder cancer cells
   483369 (P4HB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 Thioredoxin_2 Thioredoxin_7 OST3_OST6 Thioredoxin_8 AhpC-TSA ERp29_N Redoxin Glycos_trans_3N
Motif
Other DBs
NCBI-GeneID: 483369
NCBI-ProteinID: XP_540488
Ensembl: ENSCAFG00000005859
UniProt: F1PL97
Position
9
AA seq 510 aa AA seqDB search
MLRRALLCLALAALTRAGAAAPEEEDHVLVLHKGNFEEALAAHKYLLVEFYAPWCGHCKA
LAPEYAKAAGTLKAEGSEIRLAKVDATEESDLAHQYGVRGYPTIKFFKNGDTAAPREYTA
GREAEDIVNWLKKRTGPAATTLPDGAAAEALLESSEVTVIGFFKDVESDFAKQFLLAAEA
IDDIPFGITSNSDVFSKYQLSKDGVVLFKKFDEGRNNFEGEISKEKLLDFIKHNQLPLVI
EFTEQTAPKIFGGEIKTHILLFLPKSVSDYDSKLSNFKKAAERFKGKILFIFIDSDHTDN
QRILEFFGLKKEECPAVRLITLEEEMTKYKPESTELTAEKIEDFCHRFLEGKIKPHLMSQ
ELPEDWDKQPVKVLVGKNFEEVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHE
NIVIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLESGGQDGA
GDDDDLEDLEEAEEPDLEEEDDQKTVRDEL
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgccgcgctctgctctgcctggccctggccgcgctcacgcgcgcgggcgccgcc
gccccggaggaggaggaccacgtcctggtgctgcacaagggcaacttcgaggaggcgctg
gcggcgcacaagtacctgctggtggagttctacgccccttggtgcggccactgcaaggct
ctggcccccgagtacgccaaagccgccgggacactgaaggcagaaggttcggagatcagg
ctggcaaaggtcgatgccaccgaagagtctgatctggcccatcagtacggggtccgtggc
tatcccacgatcaagttcttcaaaaacggagacacggctgctcccagggagtacacagct
ggcagagaagctgaggacattgtaaactggctgaagaagcgcacaggccctgctgccact
acgctgcctgatggggccgccgcagaggccttgctggagtccagcgaggtgaccgtcatt
ggcttcttcaaggacgtggagtcggactttgccaagcagttcttgttggcggcagaggcc
attgatgacataccttttgggatcacgtccaacagcgacgtgttctccaaataccagctg
agcaaggatggggttgtcctcttcaagaagtttgacgaaggccgcaacaacttcgagggg
gaaatcagcaaggagaagctgttggacttcatcaagcacaaccagctgccactggtcatc
gagttcacagagcagacggccccgaagatcttcggaggggagatcaagacccacatcctg
ctgttcctgcccaagagcgtgtctgactacgacagcaaactgagcaacttcaagaaggcg
gccgagcgcttcaaggggaagatcctgttcatcttcatcgacagcgaccacactgacaac
cagcgcatcctcgagttctttggcctcaagaaggaggagtgccccgctgtgcgcctcatc
accctggaggaggagatgaccaagtacaagccagagtcgaccgagcttacggccgagaag
atcgaagatttctgccaccgcttcctggaaggaaagatcaagccccacctcatgagccag
gagctgcctgaagattgggacaagcagcccgtcaaggtgcttgtcgggaagaactttgag
gaggtcgctttcgatgagaaaaagaacgtctttgtggaattctacgcgccgtggtgtggc
cactgcaaacagctggctcccatttgggataagctgggagagacgtacaaggaccacgaa
aacatcgtcatcgccaagatggactcgacggctaacgaggtggaggcagtgaaagtgcac
agcttcccgacgctcaagttcttccccgccagcgcggacaggacggtcattgattacaac
ggtgagcggacactagatggttttaagaagttcttggagagcggtggccaggacggagct
ggggacgatgacgatctggaagatctggaagaagcagaggagcctgacctggaggaggag
gacgatcagaaaactgtgagagatgagctgtga

DBGET integrated database retrieval system