KEGG   Canis familiaris (dog): 483728Help
Entry
483728            CDS       T01007                                 

Gene name
KAT5, HTATIP
Definition
K(lysine) acetyltransferase 5
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
cfa  Canis familiaris (dog)
Pathway
HTLV-I infection
Class
Human Diseases; Infectious diseases; HTLV-I infection [PATH:cfa05166]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
18
AA seq 555 aa AA seqDB search
MAEVVSPVPGAGRREPGEVGRTRGPPVADPGAALSPQGEIIEGCRLPVLRRNQDNEDEWP
LAEILSVKDISGRKLFYVHYIDFNKRLDEWVTHERLDLKKIQFPKKEAKTPTKNGLPGSR
PGSPEREVRKTLDLSLQPASAQASGKTLPIPVQITLRFNLPKEREAIPGGEPDQPLSSSS
CLQPNHRSTKRKVEVVSPATPVPSETAPASVFPQNGSARRAVAAQPGRKRKSNCLGTDED
SQDSSDGIPSAPRMTGSLVSDRSHDDIVTRMKNIECIELGRHRLKPWYFSPYPQELTTLP
VLYLCEFCLKYGRSLKCLQRHLTKCDLRHPPGNEIYRKGTISFFEIDGRKNKSYSQNLCL
LAKCFLDHKTLYYDTDPFLFYVMTEYDCKGFHIVGYFSKEKESTEDYNVACILTLPPYQR
RGYGKLLIEFSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQTILEILMGLKSESGERPQ
ITINEISEITSIKKEDVISTLQYLNLINYYKGQYILTLSEDIVDGHERAMLKRLLRIDSK
CLHFTPKDWSKRGKW
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggtggtgagtccggtgcccggggcggggcggagggagccaggggaggtgggt
agaacccgaggccccccagtagccgaccctggcgccgcgctgtctccccagggggagata
atcgagggctgccgcctgcccgtgcttcggcggaaccaggacaacgaagatgagtggccc
ctggccgagatcctgagcgtgaaggacatcagtggccgcaagcttttctacgtccattac
attgacttcaacaaacgcctggatgaatgggtgacccacgagcggctggacctaaagaag
atccagttccccaagaaagaggccaagacccccaccaagaacggacttcctgggtctcgc
cccggctctccagagagagaggtgaggaagaccctggacctatctctacagccggcctcc
gcccaggccagcgggaagaccttgccaatcccggtccagatcacactccgcttcaacctg
cccaaggagcgggaggccattcccggtggcgagcctgaccagccgctctcctccagctcc
tgcctgcagcccaaccaccgctcaacgaaacggaaggtggaggtggtttcaccagcaact
ccagtgcccagcgagacagccccagcttcagtttttccccagaatggatcggcccgtagg
gcagtggcagctcaaccaggacggaagcgaaaatcaaattgcttgggcactgacgaggat
tcccaggacagctcagatggaataccgtccgctccacgcatgactggcagcttggtgtct
gaccgcagccacgacgacattgtcacccggatgaagaacattgagtgtatcgagctgggc
cggcaccgcctgaagccgtggtacttctccccatacccacaggaacttaccacattgccc
gtcctctacctctgcgagttctgcctcaaatacggccgtagtctcaagtgtctgcagcgt
cacttgaccaagtgtgacctgcgacaccccccaggcaatgagatttaccgcaagggtacc
atctctttctttgagattgatggacggaagaacaagagttattcccagaacctgtgtctt
ttggccaaatgtttcctcgaccacaagacattgtactatgatacagatcccttcctcttc
tatgtcatgacagagtatgattgcaagggcttccacatcgtcggctacttctccaaggaa
aaggaatccacagaagactacaatgtggcctgcatcctgaccctgcctccctaccagcgc
cggggctacggcaagctgctgatcgagttcagctatgaactctccaaagtggaagggaaa
acggggacccctgagaagcccctctcagaccttggcctcctatcctaccgaagctactgg
tcccagaccatcctggagatcctgatggggctgaagtcagagagcggggagaggccacag
atcaccatcaacgagatcagtgaaatcaccagcatcaagaaggaagatgtcatttctact
ctacagtacctcaatctcatcaactactacaagggccagtatatcctcacactgtctgag
gacatcgtggatgggcatgaaagagctatgctcaagcggctccttcgaatcgactccaag
tgtttgcacttcactcccaaggactggagcaagaggggaaaatggtga

DBGET integrated database retrieval system