KEGG   Canis familiaris (dog): 484087Help
Entry
484087            CDS       T01007                                 

Gene name
THBS2
Definition
thrombospondin 2
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
cfa  Canis familiaris (dog)
Pathway
Phagosome
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Malaria
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    484087 (THBS2)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    484087 (THBS2)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    484087 (THBS2)
  Cellular commiunity
   04510 Focal adhesion
    484087 (THBS2)
 Human Diseases
  Infectious diseases
   05144 Malaria
    484087 (THBS2)
Exosome [BR:cfa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   484087 (THBS2)
  Exosomal proteins of colorectal cancer cells
   484087 (THBS2)
  Exosomal proteins of bladder cancer cells
   484087 (THBS2)
Heparan sulfate/heparin binding proteins [BR:cfa00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  484087 (THBS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 1171 aa AA seqDB search
MLGALVLLALWASSSAQAGDQDEDMAFDLFRISNINRKTIGAKQFRGPDPSVPAYRFVRF
DYIPPVSADYLSRIAKIVRQKEGFFLTASLKQDPKSRGTLLALEGPGAQRQFEIVSNGPA
DTLDLTYWIDGTQHVISLEDVGLADSQWKNVTVQVTGDTYSLYVGCDLIDSFTLDEPFYE
QLRTEKTRMYVAKGSARDSHFRGLLQNVHLVFENSVEDVLSKKGCQQSQGAEANAISENT
ETLHLSPQGGPEYGGPGAQQRPEVCERSCEELSTMITELSGLHVIVNQLHENLRKVSNDN
QFLWELIGGPPKTRNMSACWQDGRFFAENETWVVDSCTKCTCKKFKTVCHQITCPPATCA
NPSFVEGECCPSCFHSLDGEEGWSPWAEWTECSTTCGSGTQQRGRSCDVTSNTCLGPSIQ
TRACSLGKCDNRIRQDGGWSHWSPWSSCSVTCGVGNITRIRLCNSPVPQMGGKNCKGSGR
ETKGCQGVPCPIDGRWSPWSPWSACTVTCAGGIRERTRVCNSPEPQHGGKDCVGDVKEQQ
MCNKRSCPIDGCLSNPCFPGAQCSSFPDGSWSCGSCPVGFLGNGTHCEDLDECAVVTDVC
FTTSKAHRCVNTNPGFHCLPCPPRYKGSQPFGVGLEAARTEKQVCEPENPCKDKTHACHR
HAECIYLGHFSDPMYKCECQTGYAGDGLICGEDSDLDGWPNKNLVCATNATYHCIKDNCP
LLPNSGQEDFDKDGTGDACDDDDDNDGVDDEKDNCQLLFNPRQFDYDKDEVGDRCDNCPY
VHNPAQIDTDNNGEGDACSVDIDGDDVFNERDNCPYVYNTDQRDTDGDGVGDHCDNCPLV
HNPDQTDVDNDLVGDQCDNNEDIDEDGHQNNQDNCPYISNANQADHDHDGQGDACDSDDD
NDGVPDDRDNCRLVFNPGQEDSDGDGRGDACKDDFDNDSIPDIDDVCPENSAISETDFRN
FQMVHLDPKGTTQIDPNWVIRHQGKELVQTANSDPGIAVGFDEFGSVDFSGTFYVNTDRD
DDYAGFVFGYQSSSRFYVVMWKQVTQTYWEDQPTRAYGYSGVSLKVVNSTTGTGEHLRNA
LWHTGNTEGQVRTLWHDPKNIGWKDYTAYRWHLTHRPKTGYIRVLVHEGKQVMADSGPIY
DQTYAGGRLGLFVFSQEMVYFSDLKYECRDV
NT seq 3516 nt NT seq  +upstreamnt  +downstreamnt
atgctcggggcgctcgtgctgcttgccctctgggcctcgtccagcgctcaagctggtgac
caggacgaggacatggccttcgaccttttcaggatcagcaacataaaccgaaagaccatc
ggggccaagcagttccgggggcccgaccccagcgtgccagcgtaccgtttcgtccggttt
gactacatcccgccggtgagcgcagattacctcagcaggatcgccaagatcgtgcggcag
aaggagggcttctttctcacggccagcctgaagcaggaccccaagtcccggggcacgctc
ctggcgctggagggccccggcgcccagcggcaattcgagattgtctccaacggcccggca
gatacgctggacctcacctactggatagacggcacccagcacgtcatctccctggaggac
gtgggcctggctgactcgcagtggaagaatgtcactgtgcaggtgacgggggacacctac
agcctgtacgtgggctgtgacctgattgatagcttcacgctggacgagcctttctacgag
cagctgcggacagaaaagaccaggatgtacgtggccaagggctctgctcgggacagtcac
ttcaggggtctgctgcagaatgtccacctagtgtttgaaaactcagtggaagatgttctg
agcaagaaaggttgtcagcaaagtcagggagccgaagccaacgccatcagtgagaacacg
gagacgctgcacctgagcccccaggggggccccgagtacgggggcccgggcgcccaacag
aggccggaggtgtgcgagcgctcctgcgaggagctgagcaccatgatcaccgagctgtcc
gggctgcacgtcatcgtgaaccagctgcatgagaacctgcggaaagtgtccaatgataac
cagtttctctgggagctcatcggcggcccgcccaagacgaggaacatgtccgcgtgctgg
caggacggccggttcttcgcggaaaacgagacctgggtggtggacagctgcacgaagtgt
acgtgcaagaaatttaagaccgtttgccaccaaatcacctgcccgccggcgacctgcgcc
aacccgtcctttgtggaaggagaatgctgcccatcctgcttccactcgctggacggcgag
gaaggctggtccccgtgggccgagtggaccgagtgctccaccacctgcggctccggcact
cagcagagagggcggtcctgtgatgtcaccagcaacacctgcttggggccgtccatccag
acgcgggcctgcagcctgggcaagtgcgacaatcgcatccggcaggacgggggctggagc
cactggtcgccatggtcttcctgctctgtgacctgcggtgtcggcaacatcacgcgcatc
cggctctgcaactcgcctgtcccccagatggggggcaagaattgcaaagggagcggccgt
gagacgaaaggctgccagggcgtcccctgtccgatcgatggccggtggagcccctggtcc
ccgtggtccgcctgcaccgtcacctgtgccggggggatccgggagcggacacgcgtctgc
aacagccccgagccccagcacggcggcaaggactgcgtgggcgatgtcaaggagcaacag
atgtgtaataagaggagctgccccatagacggctgcttatccaacccctgcttccccggc
gcccagtgcagcagcttccccgacgggtcctggtcctgcggctcctgccccgtgggcttc
ctgggcaacggcacgcactgtgaggacctggatgagtgcgccgtggtcacggacgtctgc
ttcaccacgagcaaggcccaccgctgcgtcaacacaaatccaggcttccactgcctgccg
tgcccccctcgctacaaagggagccagcccttcggcgtcggcctggaggcagccaggacc
gagaagcaggtgtgtgagcctgagaacccgtgcaaggacaagactcacgcctgccacagg
catgcggagtgcatctacctggggcatttcagcgaccccatgtacaagtgcgagtgccag
acgggctacgcgggcgacgggctcatctgcggggaggactcagacctggacggctggccc
aacaagaacctggtctgcgccaccaacgccacctaccactgcatcaaggacaactgcccc
ctgctgcctaactctgggcaggaagactttgacaaggacggcactggggacgcctgtgac
gatgatgacgacaacgacggcgtggacgatgagaaggacaactgccagcttctcttcaac
ccccggcaatttgactacgacaaggatgaggttggagaccgctgtgacaactgcccgtac
gtgcacaaccccgcgcagatcgacacggacaacaacggcgagggggacgcgtgctccgtg
gacattgacggagacgatgtgttcaacgagagggacaactgtccgtacgtctacaacacc
gaccagagagacaccgacggggacggtgtgggtgaccactgcgacaactgccccctggtg
cacaaccccgaccagaccgacgtggataatgacctcgtgggagaccagtgtgacaacaat
gaggacatcgacgaggacggacaccagaacaaccaggacaactgcccctacatctccaac
gccaaccaggccgaccacgaccacgatggccagggtgacgcctgtgactcggacgatgac
aatgatggtgtccccgatgacagggacaactgccggcttgtgttcaaccctggccaggag
gactcggatggtgatgggcgtggggacgcctgcaaggacgactttgacaatgacagcatc
ccagacattgatgatgtgtgtcccgaaaacagtgccatcagtgaaaccgacttcagaaac
tttcagatggtccacttggaccccaagggcaccacccaaatcgaccccaactgggtcatt
cgccatcaaggcaaggagctggtgcagacggccaactccgaccccggcattgctgttggg
tttgatgagtttgggtccgtggacttcagtggcacgttttatgtcaataccgaccgggac
gatgactatgccggcttcgtctttggctaccagtccagtagccgcttctacgtggtgatg
tggaagcaggtcacgcagacctactgggaagaccagcccacccgggcgtacggctactcc
ggcgtgtccctcaaggtggtgaactccaccacggggacgggcgagcacctgaggaatgct
ctgtggcatacggggaacaccgaaggtcaggtgcgcacattgtggcacgaccccaaaaat
atcggctggaaggactacactgcttacaggtggcacctgacccatagaccgaagacaggc
tacataagggtcttggtgcacgaaggaaaacaggtcatggccgactcgggacccatctat
gaccaaacctatgctggtggtcgactgggtctgtttgtcttctctcaagagatggtctat
ttctcggacctcaaatatgaatgcagagatgtctaa

DBGET integrated database retrieval system