KEGG   Canis familiaris (dog): 484491Help
Entry
484491            CDS       T01007                                 

Gene name
CYP2S1
Definition
cytochrome P450, family 2, subfamily S, polypeptide 1
Orthology
K07420  
cytochrome P450, family 2, subfamily S, polypeptide 1 [EC:1.14.14.1]
Organism
cfa  Canis familiaris (dog)
Pathway
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    484491 (CYP2S1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    484491 (CYP2S1)
Enzymes [BR:cfa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     484491 (CYP2S1)
Cytochrome P450 [BR:cfa00199]
 Cytochrome P450, animal type
  CYP2 family
   484491 (CYP2S1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 494 aa AA seqDB search
MEAAGTWTLLLALLLLLLLLALARPRTRGHLPPGPPPLPLLGNLLQLRPGALYSGLLRLS
KKYGPVFTVYLGPWRRVVVLVGHEAVQEALGGQAEEFSGRGMLATLDGTFGGHGVFFSNG
ERWRQLRRLTTLALRDLGMGKREGEELIQAEAQSLVEAFQGTVGRPFDPSLLLAQATSNI
ICSLTFGLRFPYEDKEFQAVVQAAGGTVLGVSSPWGQTYEMFSWLLQHLPGPHTQLLSHL
SVLATFAVQQVQRHKESLDTSGPPHDVVDAFLLKMAKEEQDPNTELTDKNLLMTVIYLLF
AGTVTVSTTVRYTLLLLLKYPQVQERVREELSRELGAGRAPGLGDRARLPYTDAVLHEAQ
RLLALVPMGVPRALARTTCFRGYTLPQGTEVFPLLGSVLHDPEIFDEPEEFNPDRFLDAD
GRFQKQEAFLPFSLGKRICLGEGLAHAELFLLLTTILQAFSLESPSPPGALSLQPAVSGL
FNIPPAFQLRVRPH
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggaggcggccggcacctggacgctgctgctggcgctgctgctgctgctgctgctgctg
gcgctggcgcggccccggacccgcggccacctgccccccgggcccccgccgctgccgctg
ctggggaacctcctgcagctgcggcccggggcgctgtactcggggctcctgcggctgagt
aagaagtatggcccggtgttcaccgtgtacctgggaccctggcggcgcgtggtggtcctg
gttgggcacgaggctgtgcaggaggccctgggaggtcaggctgaggagttcagtgggcgg
gggatgttggcaacgctggacgggacctttggcggccatggggttttcttctccaatggg
gagcggtggaggcagctgaggagattgaccacgctggccctgcgggacctgggcatgggg
aagcgagaaggcgaggagctgatccaggccgaggcccagagtctggtggaggcattccag
gggacagtaggacgcccatttgacccctccctgctgctggctcaggccacctctaacatc
atctgctccctcaccttcggcctccgcttcccctacgaggacaaggagttccaggccgtg
gtccaggcggccggcggcacagtgctgggggtcagctccccctggggccagacctacgag
atgttctcctggctcctgcagcacctgcccggcccccacacacagctcctcagccacttg
agtgtcctggccaccttcgccgtccagcaggtacagagacacaaggagagcctggacacc
tcgggccccccacacgacgttgtggatgccttcctgctgaagatggcaaaggaggagcaa
gacccgaacacagaactgacggacaaaaacttgctgatgacggtcatttatctgctattc
gccgggacggtcaccgtcagcaccacggtccgctacaccctcctgcttctgctgaagtac
cctcaggtccaagagcgtgtgcgggaggagctgagccgagagctgggggccggccgtgca
ccgggcctgggggaccgagcccgcctcccctacaccgacgcagttctgcatgaggcgcag
cggctgctggctctggtgcccatgggggtgccccgtgcccttgcgaggaccacctgcttc
cgagggtacacgctgccccagggcaccgaggtcttccccctccttggctctgtcctgcat
gatcctgagatctttgatgagccagaagaattcaatccagatcgattcctggatgcagac
ggacggttccagaagcaggaggcattcctgcccttctccttaggtaagcgcatctgcctg
ggagagggcctggcgcacgcagagctcttcctcctcctcaccaccatcctgcaggccttc
tccctggagagcccgagcccgccgggtgccctgagcctccagccagctgtcagcggcctt
ttcaacatccccccagccttccagctgcgagtccggccccactaa

DBGET integrated database retrieval system