KEGG   Canis familiaris (dog): 484494Help
Entry
484494            CDS       T01007                                 

Gene name
CYP2A13
Definition
cytochrome P450 family 2 subfamily A polypeptide 13
Orthology
K17685  
cytochrome P450, family 2, subfamily A, polypeptide 13 [EC:1.14.14.1]
Organism
cfa  Canis familiaris (dog)
Pathway
Metabolism of xenobiotics by cytochrome P450
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    484494 (CYP2A13)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    484494 (CYP2A13)
Enzymes [BR:cfa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     484494 (CYP2A13)
Cytochrome P450 [BR:cfa00199]
 Cytochrome P450, animal type
  CYP2 family
   484494 (CYP2A13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 494 aa AA seqDB search
MLASGLLLVALLACLTIIVLMSVWKQRKLGGKLPPGPTPLPFIGNYLQLNTEQMYNSLMK
ISERYGPVFTIHLGPRPVVVLCGHEAVKEALVDQAEEFSGRGEQATFDWLFKGYGVAFSN
GERAKQLRRFSITTLRDFGVGKRGIEERIQEEAGFLIEALRGTRGAFIDPTFFLSRTVSN
VISSIVFGDRFDYEDKEFLSLLRMMLGSFQFTATSMGQLYEMFYSVMKHLPGPQQQAFKE
LQGLEDFITKKVEQNQRTLDPNSPRDFIDSFLIRMQEEQNNPNTEFYLKNLVLTTLNLFF
AGTETVSTTLRYGFLLLMKHPDVEAKVHEEIDRVIGKNRQPKFEDRAKMPYTEAVIHEIQ
RFGDMIPMGVARRVIKDTKFREFLLPKGTEVFPMLGSVLRDAKFFSNPQDFHPQHFLDEK
GQFKKSDAFVPFSIGKRYCFGEGLARMELFLFLTTILQNFHFKSPQLPQDIDVSPKHVGF
ATIPRNYTMSFQPR
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgttggcctcagggcttcttctggtggctttgctggcctgcctgacaataattgtcttg
atgtctgtctggaagcagaggaaactgggggggaagctccctccaggacccaccccactg
cccttcatcggaaattacctgcagctgaacacagagcagatgtacaactctctcatgaag
atcagcgagcgctatggcccggtgttcaccatccatctggggccccggcctgtcgtggtg
ctgtgtggacacgaggcggtgaaggaggctctggtggaccaggcggaggaattcagcggg
cgaggcgagcaggccacatttgactggctcttcaaaggctatggcgtggcgttcagcaat
ggggagcgggccaagcagctcaggcgcttctccatcaccacactgcgggactttggagtg
ggaaagcgcggcattgaagagcgcattcaggaggaggcaggcttcctcattgaggccctc
cggggcacacgaggtgccttcatcgatcccaccttcttcctgagccgaacagtgtccaat
gtcatcagctccattgtttttggggatcgctttgactatgaggacaaagagttcctgtca
ctgctgcgtatgatgctggggagcttccagttcacagctacatctatggggcagctctat
gagatgttttactcagtgatgaaacacctgccagggccacagcaacaggcatttaaggag
ctgcagggtctggaagacttcataaccaagaaagtggagcagaaccaacgcacactggat
cccaactcccctcgagacttcattgactccttccttatccgcatgcaggaggagcagaac
aaccctaacacggagttttacttgaagaacctggtgttgaccacactgaacctcttcttt
gcgggcactgagacagtcagtacaaccctgcggtatggcttcctgctgctcatgaaacac
ccagatgtggaggccaaagtccatgaggagattgatcgggtgattggcaagaaccgtcag
cccaagtttgaggacagggccaagatgccctacacagaggcagtgatccatgagatccaa
agatttggagacatgatccccatgggcgtggcccgcagagtcatcaaggacaccaagttt
cgggagtttctcctccccaagggcactgaagtgttccctatgctgggctctgtgctgaga
gatgccaagttcttctccaacccccaagacttccaccctcagcacttcctggatgagaag
gggcagtttaagaagagtgatgcttttgtgcccttctccattggaaagcgatactgtttt
ggagaaggcctggctaggatggagctctttctcttcctcaccaccatcttgcagaacttc
cacttcaagtccccgcagctgcctcaagacatcgatgtgtcccccaaacatgtgggtttt
gcgaccatcccacgaaattacaccatgagcttccagccccgctga

DBGET integrated database retrieval system