KEGG   Canis familiaris (dog): 484633Help
Entry
484633            CDS       T01007                                 

Gene name
HDAC11
Definition
(RefSeq) histone deacetylase 11
  KO
K11418  
histone deacetylase 11 [EC:3.5.1.98]
Organism
cfa  Canis familiaris (dog)
Pathway
Alcoholism
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    484633 (HDAC11)
  Substance dependence
   05034 Alcoholism
    484633 (HDAC11)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     484633 (HDAC11)
Chromosome [BR:cfa03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class IV HDACs
     484633 (HDAC11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
20
AA seq 265 aa AA seqDB search
MQWSFAVATITEIPPVIFLPNFLVQRKVLKPLRTQTGGTIMAGKLAMERGWAINVGGGFH
HCSSDRGGGFCAYADITLAIKFLFERVEGISRATIVDLDAHQGNGHERDFMGDKRVYIMD
VYNRHIYPGDRFAKQAIRRKVELEWGTEDDEYLDKVERNLQKALQEHLPDVVVYNAGTDI
LEGDRLGGLSISPQGIVKRDELVFRVVRGRQVPILMVTSGGYQKRTARIIADSILNLYSV
GLIGSESPSLSAQNSDTPLLPPEVP
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgcagtggtccttcgctgttgcgaccatcacagagatcccccctgtcatcttcctcccg
aacttccttgtgcagaggaaggtgctgaagccccttcggacccaaacaggaggaaccatc
atggcagggaagctggccatggagcgaggctgggccatcaatgtgggtggaggcttccac
cactgctccagtgaccggggcgggggcttctgcgcctacgcggacatcacactggccatc
aagtttttgttcgagcgagtggagggcatctccagagccaccatcgttgatcttgatgcc
catcagggcaatggacatgaacgggacttcatgggtgacaagcgtgtgtacatcatggat
gtctacaaccggcacatctaccctggggaccgctttgccaagcaggccatcaggcggaag
gtggagctggaatggggtacggaggatgatgagtacctggataaagtggagcggaacctg
cagaaggccctccaagagcacctgcccgacgtcgtggtgtacaacgcgggtaccgacatc
ctcgagggtgaccgccttggggggctgtccatcagcccacagggcatcgtgaagcgggac
gaactggtgtttcgggtggtccggggccgccaggtgcccatcctcatggtgacctcgggc
ggctaccagaagcgcacggcccgcatcattgccgactccatccttaatctgtacagcgtc
gggctcatcgggtctgagtcccccagcctctcggcacagaactcagacacgcccctgctg
ccacccgaggtgccctga

DBGET integrated database retrieval system