KEGG   Canis familiaris (dog): 484633Help
Entry
484633            CDS       T01007                                 

Gene name
HDAC11
Definition
histone deacetylase 11
Orthology
K11418  
histone deacetylase 11 [EC:3.5.1.98]
Organism
cfa  Canis familiaris (dog)
Pathway
Alcoholism
Viral carcinogenesis
Class
Human Diseases; Cancers; Viral carcinogenesis [PATH:cfa05203]
Human Diseases; Substance dependence; Alcoholism [PATH:cfa05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
20
AA seq 271 aa AA seqDB search
MGLEKLHPFDAGKWGKVISFLKEEKLLSDGMLVEAREASDEDLLVVHTRRYLNELKWSFA
VATITEIPPVIFLPNFLVQRKVLKPLRTQTGGTIMAGKLAMERGWAINVGGGFHHCSSDR
GGGFCAYADITLAIKFLFERVEGISRATIVDLDAHQGNGHERDFMGDKRVYIMDVYNRHI
YPGDRFAKQAIRRKVELEWGTEDDEYLDKVERNLQKALQEHLPDVVVYNAGHREAGRTGV
SGGPGPPGAHPHGDLGRLPEAHGPHHCRLHP
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgggcctggagaaactgcacccctttgacgcagggaaatggggcaaggtgatcagcttc
ctaaaagaagagaagcttctgtcagatggcatgctggtggaggcacgggaggcttcggat
gaggacctgctggtggtgcacacaagacgctatctcaatgaattgaagtggtccttcgct
gttgcgaccatcacagagatcccccctgtcatcttcctcccgaacttccttgtgcagagg
aaggtgctgaagccccttcggacccaaacaggaggaaccatcatggcagggaagctggcc
atggagcgaggctgggccatcaatgtgggtggaggcttccaccactgctccagtgaccgg
ggcgggggcttctgcgcctacgcggacatcacactggccatcaagtttttgttcgagcga
gtggagggcatctccagagccaccatcgttgatcttgatgcccatcagggcaatggacat
gaacgggacttcatgggtgacaagcgtgtgtacatcatggatgtctacaaccggcacatc
taccctggggaccgctttgccaagcaggccatcaggcggaaggtggagctggaatggggt
acggaggatgatgagtacctggataaagtggagcggaacctgcagaaggccctccaagag
cacctgcccgacgtcgtggtgtacaacgcggggcatcgtgaagcgggacgaactggtgtt
tcgggtggtccggggccgccaggtgcccatcctcatggtgacctcgggcggctaccagaa
gcgcacggcccgcatcattgccgactccatccttaa

DBGET integrated database retrieval system