KEGG   Canis familiaris (dog): 484833Help
Entry
484833            CDS       T01007                                 

Gene name
UNC13A
Definition
unc-13 homolog A (C. elegans)
Orthology
K15293  
protein unc-13
Organism
cfa  Canis familiaris (dog)
Pathway
Synaptic vesicle cycle
Class
Organismal Systems; Nervous system; Synaptic vesicle cycle [PATH:cfa04721]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
20
AA seq 1566 aa AA seqDB search
MSLLCVGVKKAKFDGAQEKFNTYVTLKVQNVKSTTIAVRGSQPSWEQDFMFEINRLDLGL
TVEVWNKGLIWDTMVGTVWIPLRTIRQSNEEGPGEWLTLDSQVIMADSEICGTKDPTFHR
ILLDTRFELPLDIPEEEARYWAKKLEQLNAMRDQDEYSFQDEQDKPLPVPSNQCCNWNYF
GWGEQQNDDPDSAVDDRDSDYRSETSNSIPPPYYTTSQPNASVHQYSVRPPPLGSRESYS
DSMHSYEEFSEPRALSPTGSSRYASSGELSQGSSQLSEDFDPDEQSLQGSELEDERDRDS
YHSCHSSVSYHKDSPRWDQDEEELDEELDEELDEDLEDFLEEEEELPEDEEELEEEEEVP
DDIGSYTQREEVAVAEPKDFKRVSLPQAASEEEEKAPAVPAEAHDVAKAAPEPAAPEEVP
TAERAPEPEPPKSEESFRRREDEEGQEGQDSMSRAKANWLRAFNKVRLQLQEARGEGEMS
KSLWFKGGPGGGLIIIDSMPDIRKRKPIPLVSDLAMSLVQSRKAGITSALASSTLNNEEL
KNHVYKKTLQALIYPISCTTPHNFEVWTATTPTYCYECEGLLWGIARQGMRCTECGVKCH
EKCQDLLNADCLQRAAEKSSKHGAEDRTQNIIMVLKDRMKIRERNKPEIFELIQEIFAVT
KTAHTQQMKAVKQSVLDGTSKWSAKISITVVCAQGLQAKDKTGSSDPYVTVQVGKTKKRT
KTIYGNLNPVWEENFHFECHNSSDRIKVRVWDEDDDIKSRVKQRFKRESDDFLGQTIIEV
RTLSGEMDVWYNLERFVKLLDQLHNSLRIDLSMYRNNFPASSPERLQDLKSTVDLLTSIT
FFRMKVQELQSPPRASQVVKDCVKACLNSTYEYIFNNCHELYSREYQTDPAKKGEVPPEE
QGPSIKNLDFWSKLITLIVSIIEEDKNSYTPCLNQFPQELNVGKISAEVMWNLFAQDMKY
AMEEHDKHRLCKSADYMNLHFKVKWLYNEYVAELPAFKDRVPEYPAWFEPFVIQWLDENE
EVSRDFLHGALERDKKDGFQQTSEHALFSCSVVDVFSQLNQSFEIIKKLECPDPQIVGHY
MRRFAKTISNVLLQYADIISKDFASYXSKEKEKVPCILMNNTQQLRVQLEKMFEAMGGKE
LDAEASDILKELQVKLNNVLDELSRVFATSFQPHIEECVKQMGDILSQVKGTGNVPASAC
SSVAQDADNVLQPIMDLLDSNLTLFAKICEKTVLKRVLKELWKLVMNTMEKTIVLPPLTD
QTMIGTLLRKHGKGLEKGRVKLPSHSDGTQMIFNAAKELGQLSKLKDHMVREEAKSLTPK
QCAVVELALDTIKQYFHAGGVGLKKTFLEKSPDLQSLRYALSLYTQATDLLIKTFVQTQA
AQGSGVEDPVGEVSVHVELFTHPGTGEHKVTVKVVAANDLKWQTSGIFRPFIEVNIIGPQ
LSDKKRKFATKSKNNSWAPKYNESFQFTVGADAGPECYELQVCVKDYCFAREDRTVGLAV
LGLGELAQRWSAGCWLALGGLSHVDYTRLTLVGILADRINDNVGKDFVELLSDSPFDKRG
RRCAAP
NT seq 4701 nt NT seq  +upstreamnt  +downstreamnt
atgtctctactttgcgtaggagtaaaaaaagccaagtttgatggtgcccaagagaaattc
aacacatacgtgaccctgaaggtgcaaaatgtcaagagcacgaccatcgcagtgcggggc
agccagcccagctgggagcaggatttcatgtttgagattaaccgcctggatttggggctg
acggtggaggtgtggaacaagggtctcatctgggacacaatggtgggcaccgtgtggatt
cccctgcggaccatccgccagtccaatgaagaaggccctggagaatggctaacattggac
tctcaagtcatcatggcagacagtgagatctgcggcaccaaggaccccaccttccaccgc
atcctccttgacacccgcttcgagctgcctttagacattcctgaggaggaggcgcgctac
tgggccaagaagctagagcagctgaatgccatgagggaccaggatgagtattcattccaa
gatgaacaagacaagcctctccctgtccccagcaaccagtgttgcaactggaattatttt
ggctggggtgagcagcagaatgatgaccctgacagtgcagtggacgatcgtgacagtgac
tatcgcagtgagacaagcaacagcatcccgccaccctattacactacatcccagcccaat
gcctcagtccaccagtactctgtccgcccgccacccctgggttcccgggaatcctacagt
gactccatgcacagttatgaggagttctccgagccacgggccctcagccccactggcagt
agccgctatgcctcctcgggagaactgagccagggcagctcgcagctgagcgaggacttc
gaccccgacgagcagagtctgcagggctccgagctggaggacgagcgggaccgggactcg
taccactcctgccacagctcagtcagctaccacaaggactcgccgcgctgggaccaggac
gaggaggagctggacgaagaactggacgaagagctggacgaggatctggaggacttcctg
gaggaggaggaggagctgcccgaggatgaggaggagctggaggaggaggaagaggtgcct
gatgacataggtagctacacccagcgtgaagaggtggccgtggctgagcccaaggacttc
aagcgtgtcagcctcccgcaggcggcatctgaggaggaggagaaggctccggctgtacct
gctgaggcccacgacgtggccaaggcggcccctgaaccagcggcaccggaggaggtgccc
acagctgagcgggcacctgagccggaaccccccaagtccgaggagagtttcaggcgacga
gaggatgaggaaggccaggagggtcaggactccatgtccagggccaaggccaactggctt
cgagccttcaacaaagtgcggctgcagctgcaggaggcccgaggagaaggagaaatgtct
aaatcgctgtggttcaaaggcggccctggaggtggcctcatcatcattgacagcatgcca
gacatccgcaagaggaagcccattccactcgtgagcgacctggccatgtccctggtccag
tccagaaaagcaggcatcacctcagccttggcctccagcactttgaacaacgaagagctg
aaaaaccacgtttacaagaagaccctgcaagccttaatctatcccatctcctgcacgacg
ccgcacaacttcgaggtgtggacggccaccacgcccacctactgctacgagtgcgagggg
ctgctgtggggcatcgcgcggcagggcatgcgctgcaccgagtgcggggtcaagtgccac
gagaagtgccaggacctgctcaacgcagattgcctgcagcgggctgcagaaaagagctcc
aagcacggggcggaggaccgcacgcagaacatcatcatggtgctcaaggaccgcatgaag
atccgggagcgcaacaaacctgagatcttcgagctcatccaggagatcttcgccgtgacc
aagaccgcgcatacacagcagatgaaggcggtcaagcagagcgtgctggacggcacatcc
aagtggtcggccaagatcagcatcactgtggtctgtgcccagggtttgcaggcaaaggac
aagacaggatccagcgacccctatgtcactgtccaggttgggaagaccaagaaacggaca
aaaactatctatgggaacctgaaccctgtgtgggaggagaacttccactttgaatgtcac
aactcctcagaccgaatcaaggtgcgggtctgggatgaggatgatgacatcaaatcccgt
gtgaagcagcggtttaagagggaatctgatgacttcctgggacagacgatcatcgaggtg
cggacactcagcggcgagatggacgtgtggtacaacctggagcgctttgtcaagctcctg
gaccagctgcacaactccctgcggattgacctctccatgtatcggaataacttcccagcc
agcagcccagagagactccaggacctcaaatccactgtggaccttctcaccagcatcacc
ttctttcggatgaaggtgcaagaactccagagcccaccccgagccagccaggtggtgaaa
gactgtgtgaaagcctgcctcaactctacttatgaatacatcttcaacaactgtcatgaa
ctctacagtcgggagtaccagacagacccggccaagaagggagaagttcccccagaggaa
cagggacccagcatcaagaaccttgacttttggtccaagctgatcactctcatagtgtcc
atcattgaggaagacaaaaattcctacactccctgcctcaaccagtttccccaggagctg
aacgtgggtaaaatcagtgccgaagtgatgtggaacctgtttgcccaggacatgaagtat
gccatggaggagcatgacaagcatcgcctatgcaagagcgctgactacatgaacctacac
ttcaaggttaagtggctgtacaatgagtatgtggcagagcttcctgccttcaaggaccgc
gtgcctgagtaccctgcgtggtttgagccctttgtcatccaatggctggacgagaatgag
gaggtgtcccgggatttcctacatggggccctggagcgagacaagaaggatgggttccag
cagacgtcagagcatgccctattctcctgctccgtggtggatgtcttctcccagctcaac
cagagctttgagattatcaagaaactcgagtgtcctgacccccagattgtggggcactat
atgaggcgctttgccaagaccatcagtaatgtgcttctccagtacgcagacatcatctcc
aaggacttcgcctcctactgatccaaggagaaggagaaagtgccctgcatcctcatgaac
aacactcagcagctccgagtgcagctagagaagatgttcgaagccatgggagggaaggag
ctggatgccgaggccagtgacatcttgaaggagctccaggtgaagctcaacaatgtcttg
gatgaactcagccgggtgtttgctaccagcttccagccacacattgaggagtgcgtaaag
cagatgggtgacatcctcagccaggtgaagggcacaggcaatgtgccagccagtgcctgc
agcagtgtggcccaggatgctgacaatgtgctgcaacccatcatggacctgctggacagc
aacctgactctctttgccaaaatctgtgagaagacagtgctgaagcgggtgctaaaggag
ttgtggaagttggtcatgaacaccatggagaagaccatcgttctgccgcccctcactgac
cagacgatgatcggcaccctcttgagaaaacatggcaagggattagaaaagggcagggtg
aaattgccaagccactcagatggaacccagatgatcttcaatgcagccaaagagctgggt
cagctgtctaaactcaaggaccacatggtacgagaagaagccaagagcttgaccccaaag
cagtgtgcagtcgtcgaactggccctggacaccatcaagcaatacttccacgcaggtggc
gtgggcctcaagaagacctttctggaaaagagcccggacctgcagtccctgcgctacgcc
ctgtccctctacacgcaggccactgacctgctcatcaagaccttcgtgcagacgcaggcg
gcccagggctcgggtgtggaagaccccgtgggtgaagtttcagtccacgttgagctcttc
actcatccaggaaccggggaacacaaggtcactgtgaaagtcgtggctgccaatgacctc
aagtggcagacttctggcattttccggccatttatcgaggtcaacatcattgggccccag
ctcagtgacaagaaacgcaagtttgcaaccaaatccaagaataacagctgggcccccaag
tacaacgagagcttccagttcacggtgggcgccgacgcgggcccggagtgctacgagctg
caggtgtgcgtcaaggactactgcttcgcgcgcgaggaccgcacggtggggctggccgtg
ctggggctgggggagctggcccagcggtggagcgccggctgctggctggcactgggcggc
ctcagccatgtggactacacgcgcctcacattggtgggcatcctggctgatcgcatcaac
gacaacgtgggcaaggacttcgtcgagctcttgtcggactcccccttcgacaagaggggg
cggcgctgcgctgcgccctaa

DBGET integrated database retrieval system