KEGG   Canis familiaris (dog): 484833Help
Entry
484833            CDS       T01007                                 

Gene name
UNC13A
Definition
(RefSeq) unc-13 homolog A (C. elegans)
  KO
K15293  
protein unc-13 A/B/C
Organism
cfa  Canis familiaris (dog)
Pathway
Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Organismal Systems
  Nervous system
   04721 Synaptic vesicle cycle
    484833 (UNC13A)
Membrane trafficking [BR:cfa04131]
 SNARE
  SNARE associated proteins
   Syntaxin-binding proteins
    484833 (UNC13A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
20
AA seq 1598 aa AA seqDB search
MSLLCVGVKKAKFDGAQEKFNTYVTLKVQNVKSTTIAVRGSQPSWEQDFMFEINRLDLGL
TVEVWNKGLIWDTMVGTVWIPLRTIRQSNEEGPGEWLTLDSQVIMADSEICGTKDPTFHR
ILLDTRFELPLDIPEEEARYWAKKLEQLNAMRDQDEYSFQDEQDKPLPVPSNQCCNWNYF
GWGEQQNDDPDSAVDDRDSDYRSETSNSIPPPYYTTSQPNASVHQYSVRPPPLGSRESYS
DSMHSYEEFSEPRALSPTGSSRYASSGELSQGSSQLSEDFDPDEQSLQGSELEDERDRDS
YHSCHSSVSYHKDSPRWDQDEEELDEELDEELDEDLEDFLEEEEELPEDEEELEEEEEVP
DDIGSYTQREEVAVAEPKDFKRVSLPQAASEEEEKAPAVPAEAHDVAKAAPEPAAPEEVP
TAERAPEPEPPKSEESFRRREDEEGQEGQDSMSRAKANWLRAFNKVRLQLQEARGEGEMS
KSLWFKGGPGGGLIIIDSMPDIRKRKPIPLVSDLAMSLVQSRKAGITSALASSTLNNEEL
KNHVYKKTLQALIYPISCTTPHNFEVWTATTPTYCYECEGLLWGIARQGMRCTECGVKCH
EKCQDLLNADCLQRAAEKSSKHGAEDRTQNIIMVLKDRMKIRERNKPEIFELIQEIFAVT
KTAHTQQMKAVKQSVLDGTSKWSAKISITVVCAQGLQAKDKTGSSDPYVTVQVGKTKKRT
KTIYGNLNPVWEENFHFECHNSSDRIKVRVWDEDDDIKSRVKQRFKRESDDFLGQTIIEV
RTLSGEMDVWYNLVSTHPIWQPLLAATLDPHVPASIRLSPLLPQKERFVKLLDQLHNSLR
IDLSMYRNNFPASSPERLQDLKSTVDLLTSITFFRMKVQELQSPPRASQVVKDCVKACLN
STYEYIFNNCHELYSREYQTDPAKKGEVPPEEQGPSIKNLDFWSKLITLIVSIIEEDKNS
YTPCLNQFPQELNVGKISAEVMWNLFAQDMKYAMEEHDKHRLCKSADYMNLHFKVKWLYN
EYVAELPAFKDRVPEYPAWFEPFVIQWLDENEEVSRDFLHGALERDKKDGFQQTSEHALF
SCSVVDVFSQLNQSFEIIKKLECPDPQIVGHYMRRFAKTISNVLLQYADIISKDFASYXS
KEKEKVPCILMNNTQQLRVQLEKMFEAMGGKELDAEASDILKELQVKLNNVLDELSRVFA
TSFQPHIEECVKQMGDILSQVKGTGNVPASACSSVAQDADNVLQPIMDLLDSNLTLFAKI
CEKTVLKRVLKELWKLVMNTMEKTIVLPPLTDQTMIGTLLRKHGKGLEKGRVKLPSHSDG
TQMIFNAAKELGQLSKLKDHMVREEAKSLTPKQCAVVELALDTIKQYFHAGGVGLKKTFL
EKSPDLQSLRYALSLYTQATDLLIKTFVQTQAAQGSGVEDPVGEVSVHVELFTHPGTGEH
KVTVKVVAANDLKWQTSGIFRPFIEVNIIGPQLSDKKRKFATKSKNNSWAPKYNESFQFT
VGADAGPECYELQVCVKDYCFAREDRTVGLAVLGLGELAQRWSAGCWLALGGLSHVDYTR
LTLVGILADRINDNVGKDFVELLSDSPFDKRGRRCAAP
NT seq 4797 nt NT seq  +upstreamnt  +downstreamnt
atgtctctactttgcgtaggagtaaaaaaagccaagtttgatggtgcccaagagaaattc
aacacatacgtgaccctgaaggtgcaaaatgtcaagagcacgaccatcgcagtgcggggc
agccagcccagctgggagcaggatttcatgtttgagattaaccgcctggatttggggctg
acggtggaggtgtggaacaagggtctcatctgggacacaatggtgggcaccgtgtggatt
cccctgcggaccatccgccagtccaatgaagaaggccctggagaatggctaacattggac
tctcaagtcatcatggcagacagtgagatctgcggcaccaaggaccccaccttccaccgc
atcctccttgacacccgcttcgagctgcctttagacattcctgaggaggaggcgcgctac
tgggccaagaagctagagcagctgaatgccatgagggaccaggatgagtattcattccaa
gatgaacaagacaagcctctccctgtccccagcaaccagtgttgcaactggaattatttt
ggctggggtgagcagcagaatgatgaccctgacagtgcagtggacgatcgtgacagtgac
tatcgcagtgagacaagcaacagcatcccgccaccctattacactacatcccagcccaat
gcctcagtccaccagtactctgtccgcccgccacccctgggttcccgggaatcctacagt
gactccatgcacagttatgaggagttctccgagccacgggccctcagccccactggcagt
agccgctatgcctcctcgggagaactgagccagggcagctcgcagctgagcgaggacttc
gaccccgacgagcagagtctgcagggctccgagctggaggacgagcgggaccgggactcg
taccactcctgccacagctcagtcagctaccacaaggactcgccgcgctgggaccaggac
gaggaggagctggacgaagaactggacgaagagctggacgaggatctggaggacttcctg
gaggaggaggaggagctgcccgaggatgaggaggagctggaggaggaggaagaggtgcct
gatgacataggtagctacacccagcgtgaagaggtggccgtggctgagcccaaggacttc
aagcgtgtcagcctcccgcaggcggcatctgaggaggaggagaaggctccggctgtacct
gctgaggcccacgacgtggccaaggcggcccctgaaccagcggcaccggaggaggtgccc
acagctgagcgggcacctgagccggaaccccccaagtccgaggagagtttcaggcgacga
gaggatgaggaaggccaggagggtcaggactccatgtccagggccaaggccaactggctt
cgagccttcaacaaagtgcggctgcagctgcaggaggcccgaggagaaggagaaatgtct
aaatcgctgtggttcaaaggcggccctggaggtggcctcatcatcattgacagcatgcca
gacatccgcaagaggaagcccattccactcgtgagcgacctggccatgtccctggtccag
tccagaaaagcaggcatcacctcagccttggcctccagcactttgaacaacgaagagctg
aaaaaccacgtttacaagaagaccctgcaagccttaatctatcccatctcctgcacgacg
ccgcacaacttcgaggtgtggacggccaccacgcccacctactgctacgagtgcgagggg
ctgctgtggggcatcgcgcggcagggcatgcgctgcaccgagtgcggggtcaagtgccac
gagaagtgccaggacctgctcaacgcagattgcctgcagcgggctgcagaaaagagctcc
aagcacggggcggaggaccgcacgcagaacatcatcatggtgctcaaggaccgcatgaag
atccgggagcgcaacaaacctgagatcttcgagctcatccaggagatcttcgccgtgacc
aagaccgcgcatacacagcagatgaaggcggtcaagcagagcgtgctggacggcacatcc
aagtggtcggccaagatcagcatcactgtggtctgtgcccagggtttgcaggcaaaggac
aagacaggatccagcgacccctatgtcactgtccaggttgggaagaccaagaaacggaca
aaaactatctatgggaacctgaaccctgtgtgggaggagaacttccactttgaatgtcac
aactcctcagaccgaatcaaggtgcgggtctgggatgaggatgatgacatcaaatcccgt
gtgaagcagcggtttaagagggaatctgatgacttcctgggacagacgatcatcgaggtg
cggacactcagcggcgagatggacgtgtggtacaacctggtaagtactcacccaatatgg
cagccacttttagctgctacacttgacccccatgtccctgcttccatccgtctttctcct
ctccttcctcagaaagagcgctttgtcaagctcctggaccagctgcacaactccctgcgg
attgacctctccatgtatcggaataacttcccagccagcagcccagagagactccaggac
ctcaaatccactgtggaccttctcaccagcatcaccttctttcggatgaaggtgcaagaa
ctccagagcccaccccgagccagccaggtggtgaaagactgtgtgaaagcctgcctcaac
tctacttatgaatacatcttcaacaactgtcatgaactctacagtcgggagtaccagaca
gacccggccaagaagggagaagttcccccagaggaacagggacccagcatcaagaacctt
gacttttggtccaagctgatcactctcatagtgtccatcattgaggaagacaaaaattcc
tacactccctgcctcaaccagtttccccaggagctgaacgtgggtaaaatcagtgccgaa
gtgatgtggaacctgtttgcccaggacatgaagtatgccatggaggagcatgacaagcat
cgcctatgcaagagcgctgactacatgaacctacacttcaaggttaagtggctgtacaat
gagtatgtggcagagcttcctgccttcaaggaccgcgtgcctgagtaccctgcgtggttt
gagccctttgtcatccaatggctggacgagaatgaggaggtgtcccgggatttcctacat
ggggccctggagcgagacaagaaggatgggttccagcagacgtcagagcatgccctattc
tcctgctccgtggtggatgtcttctcccagctcaaccagagctttgagattatcaagaaa
ctcgagtgtcctgacccccagattgtggggcactatatgaggcgctttgccaagaccatc
agtaatgtgcttctccagtacgcagacatcatctccaaggacttcgcctcctactgatcc
aaggagaaggagaaagtgccctgcatcctcatgaacaacactcagcagctccgagtgcag
ctagagaagatgttcgaagccatgggagggaaggagctggatgccgaggccagtgacatc
ttgaaggagctccaggtgaagctcaacaatgtcttggatgaactcagccgggtgtttgct
accagcttccagccacacattgaggagtgcgtaaagcagatgggtgacatcctcagccag
gtgaagggcacaggcaatgtgccagccagtgcctgcagcagtgtggcccaggatgctgac
aatgtgctgcaacccatcatggacctgctggacagcaacctgactctctttgccaaaatc
tgtgagaagacagtgctgaagcgggtgctaaaggagttgtggaagttggtcatgaacacc
atggagaagaccatcgttctgccgcccctcactgaccagacgatgatcggcaccctcttg
agaaaacatggcaagggattagaaaagggcagggtgaaattgccaagccactcagatgga
acccagatgatcttcaatgcagccaaagagctgggtcagctgtctaaactcaaggaccac
atggtacgagaagaagccaagagcttgaccccaaagcagtgtgcagtcgtcgaactggcc
ctggacaccatcaagcaatacttccacgcaggtggcgtgggcctcaagaagacctttctg
gaaaagagcccggacctgcagtccctgcgctacgccctgtccctctacacgcaggccact
gacctgctcatcaagaccttcgtgcagacgcaggcggcccagggctcgggtgtggaagac
cccgtgggtgaagtttcagtccacgttgagctcttcactcatccaggaaccggggaacac
aaggtcactgtgaaagtcgtggctgccaatgacctcaagtggcagacttctggcattttc
cggccatttatcgaggtcaacatcattgggccccagctcagtgacaagaaacgcaagttt
gcaaccaaatccaagaataacagctgggcccccaagtacaacgagagcttccagttcacg
gtgggcgccgacgcgggcccggagtgctacgagctgcaggtgtgcgtcaaggactactgc
ttcgcgcgcgaggaccgcacggtggggctggccgtgctggggctgggggagctggcccag
cggtggagcgccggctgctggctggcactgggcggcctcagccatgtggactacacgcgc
ctcacattggtgggcatcctggctgatcgcatcaacgacaacgtgggcaaggacttcgtc
gagctcttgtcggactcccccttcgacaagagggggcggcgctgcgctgcgccctaa

DBGET integrated database retrieval system