KEGG   Canis familiaris (dog): 484993Help
Entry
484993            CDS       T01007                                 

Gene name
PNPLA6
Definition
patatin-like phospholipase domain containing 6
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
cfa  Canis familiaris (dog)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    484993 (PNPLA6)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     484993 (PNPLA6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
20
AA seq 1434 aa AA seqDB search
MGGGAAARPAGNNLKGPRLGRWAESYRCWRGADPGCWPLAPHQPSPAREAIPAASTKGLA
RLVVRGRTRTRGRGETGPERRRAPVPPAAYSPGLRAAPDLPPSRKQLMEAPLQTGMVLGV
MIGAGVAVLVTAVLILLLVRRLRVPKTPAPEGPRYRFRKRDKVLFYGRKIMRKVSQSTSS
LVDASVSTTSRPRMKKKLKMLNIAKKILRIQKEAPTLQRKEPPPAVLEADLTEGDLANSH
LPSEVLYMLKNVRVLGHFEKPLFLELCRHMVFQRLSQGDYVFRPGQPDASIYVVQDGLLE
LCLPGPDGKECVVKEVVPGDSVNSLLSILDVITGHQHPQRTVSARAARDSTVLRLPVEAF
SAVFTKYPESLVRVVQIIMVRLQRVTFLALHNYLGLTNELFSHEIQPLRLFPSPGLPSRT
SPVRGSKRVVSASAAEEPRETPGRPPDPTGAPLPGPTGDPVKPTSLEAPSAPLLSRCISM
PVDISGLQGGPRSDFDMAYERGRISVSLQEEASGGPQAAPARTPTQEPREQPAGACEHSY
CEDELATGGCPFGPYQGRQTSSIFEAAKRELAKLMRIEDPSLLNSRVLLHHAKAGTIIAR
QGDQDVSLHFVLWGCLHVYQRMIDKAEDVCLFVAQPGELVGQLAVLTGEPLIFTLRAQRD
CTFLRISKSDFYEIMRAQPSVVLSAAHTVAARMSPFVRQMDFAIDWTAVEAGRALYRQGD
RSDCTYIVLNGRLRSVIQRGSGKKELVGEYGRGDLIGVVEALTRQPRATTVHAVRDTELA
KLPEGTLGHIKRRYPQVVTRLIHLLSQKILGNLQQLQGPFPGSGLGVPPHSELTNPASNL
ATVAVLPVCAEVPMVAFTLELQHALQAIGPTLLLXSDIIRARLGASALDSIQEFRLSGWL
AQQEDAHRIVLYQTDASLTPWTVRCLRQADCILIVGLGDQEPTLGQLEQMLENTAVRALK
QLVLLHREEGPGPTRTVEWLNMRSWCSGHLHLRCPRRLFSRRSPAKLHELYEKVFSRRAD
RHSDFSRLARVLTGNTIALVLGGGGARGCSHIGVLKALEEAGVPVDLVGGTSIGSFIGAL
YAEERSASRTKQRAREWAKSMTSVMEPVLDLTYPVTSMFTGSAFNRSIHRVFQDKQIEDL
WLPYFNVTTDITASAMRVHKDGSLWRYVRASMTLSGYLPPLCDPKDGHLLMDGGYINNLP
ADIARSMGAKTVIAIDVGSQDETDLSTYGDSLSGWWLLWKRLNPWADKIKVPDMAEIQSR
LAYVSCVRQLEVVKSSSYCEYLRPPIDCFKTMDFGKFDQIYDVGYQYGKAVFGGWSRGDI
IEKMLTDRRSADLNESRRADVLAFPSSGFTDLAEIVSRIEPPTTSYVSDGCADGEESDCL
TEYEEDAGPDCSRDEGGSPEGASPSTASEMEEEKSVLRHRRCVPLEPPTTAADA
NT seq 4305 nt NT seq  +upstreamnt  +downstreamnt
atggggggcggggctgcggcgcgccctgcggggaataatttaaaggggccgcgcctgggg
cgctgggcggaaagctaccggtgttggcgcggagcggaccctggttgctggcccctggcg
ccccaccagccgtccccggccagagaagccatccccgcggcgagtacgaagggtctggca
aggctcgtggtaaggggcaggactcggactcggggcaggggagagacgggcccagagcga
cgacgtgcaccggttcctcctgctgcttattccccaggactccgggctgcaccggaccta
ccgcccagtcggaagcaactgatggaggctccactgcaaacgggaatggtgctgggcgtg
atgattggggccggagtcgcggtgctggtcacggccgtgctcatcctcctgctggtgcgg
aggctgcgagtgccgaaaacgccagccccggaggggccccgctaccgattccggaagagg
gacaaagtgctcttctacggtcggaagattatgcggaaggtatcacagtccacttcctcc
ctggtggacgcgtctgtctccaccacttcccggccccgcatgaagaagaaacttaagatg
ctcaacattgccaagaagatcctgcgtatccagaaggaggcaccaacgctgcagcggaag
gagcccccacctgcggtgctggaggctgacctgacggagggtgacctggctaactcccac
ctgccctccgaggtgctctacatgctcaagaatgtccgggtgctgggccacttcgagaaa
ccactcttcttggagctctgccgacacatggttttccagcggctcagccagggtgactat
gtcttccggccaggccagccagatgccagtatctatgtggtgcaggatgggctgctggag
ctctgtctgccagggcctgatgggaaggagtgtgtggtgaaggaggtggtccctggggac
agtgtcaacagccttctgagcatcctggacgtcatcaccggccaccagcacccccagcgg
acggtgtctgcccgggcagcccgcgactccacagtgctgcggctgccagtggaggccttc
tccgccgtgttcaccaagtaccccgagagcttggtgcgggtcgtacagatcatcatggtg
aggctgcagcgggtcacctttctggcacttcacaactacctgggtctgaccaacgagctg
tttagccacgagatccagcccctgcgcctcttccccagccctggccttccctcccgtacc
agccctgtgcgtggctccaagcgggtggtcagtgcctcagctgctgaggagcctcgggag
actcctggccggccgcctgaccccaccggggccccactgcctggacctacaggggacccg
gtgaagcccacatccctggaggctccctctgcccccctgctgagtcgctgcatctccatg
cccgtggacatctcaggcttgcaaggtggcccccgctcagactttgacatggcgtatgaa
cgtggccggatctccgtgtccctgcaggaagaggcttcaggggggccccaggcagctcct
gctcggacccccactcaggagccccgggagcagccagcaggtgcctgtgagcacagctac
tgcgaggacgagttggccaccggtgggtgccccttcgggccctaccagggacgccagaca
agcagcatcttcgaggcagcgaagcgggagctggcaaaactgatgcggattgaggaccca
tccctcctgaacagccgggtcttgctacatcatgccaaagctggcaccatcatcgcccgc
cagggggaccaggatgtgagcctgcactttgtgctgtggggctgcttgcatgtctaccaa
cgcatgatcgacaaggcagaggatgtatgcttgttcgtggcacaacctggggagctggtg
gggcaactggcagtgctcacgggcgagcccctcatcttcacactgagagcccagcgtgat
tgcaccttcctgaggatttctaagtccgacttctatgagatcatgcgtgcacagcctagt
gtggtgctgagtgctgcgcacaccgtggccgccaggatgtcgccctttgtgcgccagatg
gactttgccatcgattggacggcggtggaggcaggccgcgctttgtacaggcagggtgac
cgctccgactgcacctacattgtgctcaatgggcggctgcgcagtgtcatccagcgcggc
agcggcaagaaggagctggtgggcgagtacggccgtggggacctcattggcgtggtggag
gcgctgacacggcagccacgtgccacaacggtgcacgcggtgcgggacacggagctggcc
aaactcccggagggcactctgggccacatcaaacgtcgatacccacaggtcgtgactcgc
ctcatccacctgctaagccagaaaattttggggaatttgcagcagctgcaaggacccttc
ccaggctcaggactaggcgttccccctcactcggagcttaccaacccagccagcaacctg
gcaacagtggccgtcctgccagtgtgtgccgaggtgcccatggtggccttcactctggag
ctgcagcatgctctgcaagcgattggtcccacgctcctcctcnacagtgacatcatccgg
gcccgcctgggggcctctgctctggatagcatccaggagttccggctctcagggtggctt
gcccagcaggaggatgcgcaccgcatagtgctctaccagactgacgcgtcgctgacgccc
tggacagtccgctgcttacgccaggccgactgcatcctcatcgtgggcctgggcgaccag
gagcccacgctcggccagctggagcaaatgctggagaatacagcagtgcgtgccctcaag
cagctggtgctgttacaccgtgaggaaggcccaggccctacacgcactgtggagtggctc
aacatgcgcagctggtgctcggggcacttgcatctgcgctgtccacgccgcctcttctct
cgccgcagccctgccaagctgcacgagctctacgagaaggttttctcgaggcgcgcggac
cggcacagcgacttctcccgcttggcacgggtgctcacaggcaacaccatcgccctggtg
ctgggtgggggcggggccaggggctgctcacatatcggggtgctgaaggcattggaggag
gcaggcgtccctgtcgacctggtgggtggcacatccatcggctccttcatcggggccttg
tacgcagaggagcgaagcgccagtcgtaccaagcagcgggcccgggagtgggccaagagc
atgacttcggtgatggagcctgtgctggacctcacgtaccctgtcacctccatgttcacc
ggctcggccttcaaccgcagcatccatcgagtcttccaggacaagcagatcgaggacctg
tggctgccgtatttcaatgtgaccacggacatcaccgcctcagccatgcgtgtccacaaa
gatggctccctgtggcggtacgtacgcgccagcatgacgctctcgggctacctgcccccg
ctgtgcgacccgaaggacgggcacctcctcatggacggcggctacatcaacaacctgcca
gcggacatcgcccgcagcatgggtgccaagacagtcatcgccatcgacgtgggaagccag
gatgagacggacctcagcacctatggggacagcctgtctggctggtggctgctgtggaag
cggctgaacccctgggcagacaagatcaaggttccagacatggccgagatccagtctcgc
ctggcctacgtgtcctgcgtgcggcagctggaggtggttaagtccagctcctactgcgag
tacctgcgcccgcccatcgactgcttcaagaccatggacttcgggaagttcgatcagatc
tatgatgtgggctaccagtacgggaaggcggtgttcgggggctggagccggggcgacatc
attgaaaagatgctcacggaccggaggtctgctgaccttaacgagagccgccgtgcggac
gtgctggccttccccagctctggcttcaccgacttggcggagattgtgtctcggatcgag
ccccctacaaccagctacgtttccgatggctgtgccgatggggaggagtcggactgcctg
acggagtatgaggaggatgcgggccctgactgctcacgggatgaaggggggtctcccgag
ggcgcgagccccagcactgcctctgagatggaggaggagaagtcagttctccggcaccgg
cgctgtgtgcccctggagcctcccaccacggctgcggatgcctga

DBGET integrated database retrieval system