KEGG   Canis familiaris (dog): 485004Help
Entry
485004            CDS       T01007                                 

Gene name
MAP2K7
Definition
mitogen-activated protein kinase kinase 7
Orthology
K04431  
mitogen-activated protein kinase kinase 7 [EC:2.7.12.2]
Organism
cfa  Canis familiaris (dog)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Protein processing in endoplasmic reticulum
Osteoclast differentiation
Toll-like receptor signaling pathway
T cell receptor signaling pathway
Fc epsilon RI signaling pathway
TNF signaling pathway
Neurotrophin signaling pathway
GnRH signaling pathway
Influenza A
Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    485004 (MAP2K7)
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    485004 (MAP2K7)
   04012 ErbB signaling pathway
    485004 (MAP2K7)
   04668 TNF signaling pathway
    485004 (MAP2K7)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    485004 (MAP2K7)
   04660 T cell receptor signaling pathway
    485004 (MAP2K7)
   04664 Fc epsilon RI signaling pathway
    485004 (MAP2K7)
  Endocrine system
   04912 GnRH signaling pathway
    485004 (MAP2K7)
  Nervous system
   04722 Neurotrophin signaling pathway
    485004 (MAP2K7)
  Development
   04380 Osteoclast differentiation
    485004 (MAP2K7)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    485004 (MAP2K7)
   05169 Epstein-Barr virus infection
    485004 (MAP2K7)
Enzymes [BR:cfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     485004 (MAP2K7)
Protein kinases [BR:cfa01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   485004 (MAP2K7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
20
AA seq 447 aa AA seqDB search
MAASSLEQKLSRLEAKLKQENREARRRIDLNLDISPQRPRPTLQLPLANDGGSRSPSSEN
SPQHPTPPARPRHMLGLPSTLFTPRSMESIEIDQKLQEIMKQTGYLTIGGQVPPRWGSVL
GWGRGAEAGTSSSSGCPCQRYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHVIAVKQMR
RSGNKEENKRILMDLDVVLKSHDCPYIVQCFGTFITNTDVFIAMELMGTCAEKLKKRVQG
PIPERILGKMTVAIVKALYYLKEKHGVIHRDVKPSNILLDERGQIKLCDFGISGRLVDSK
AKTRSAGCAAYMAPERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVL
TKVLQEEPPLLPGHMGFSGDFQSFVKDCLTKDHRKRPKYNKLLEHSFIKRYEMLEVDVAS
WFKDVMAKTESPRTSGVLSQHHLPFFR
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtcctccctggagcagaagctgtcccgcctggaagcaaagctgaagcaggag
aaccgcgaggcccggcggaggatcgacctcaacctggatatcagcccccagcggcccagg
cccaccctgcagctcccgctggccaatgatggcggcagccgctcaccgtcctccgagaac
tcgccacagcaccccacaccccctgcccggccccgccacatgctggggcttccgtcaacc
ttgttcaccccccgcagcatggagagcatcgagattgaccagaagctgcaggagatcatg
aagcagacgggctacctgaccatcggaggccaggtaccacccaggtggggctcggtcttg
gggtgggggcgcggtgcagaggctggcacatcctccagctctggctgtccttgccagcgc
taccaggcagaaatcaacgacctggagaacctgggggagatgggcagcggcacttgtggt
caggtgtggaagatgcgcttcaggaagacgggccacgtcatcgctgtcaagcaaatgcgg
cgctccgggaataaggaggagaacaagcggatcctcatggacctggacgtggtgctcaag
agccacgactgcccctacattgtgcagtgtttcgggactttcatcactaacacggacgtc
ttcattgccatggagctcatgggcacgtgcgctgagaagctcaagaagcgggtgcagggc
cctatccccgagcggatcctgggcaagatgacggtggcgatcgtgaaggcgctgtactac
ctgaaggagaagcatggtgtgatccaccgtgacgtcaagccctcgaacatcctgctggac
gagcggggccagatcaagctctgtgacttcggcatcagtggccgtcttgttgattctaag
gctaagacgcgcagcgccggctgtgccgcctacatggcacctgagcgcatagatcctccg
gaccccaccaagccagactatgatatccgggctgacgtgtggagcctgggcatctccttg
gtggagctggcgacgggacagtttccctacaagaactgcaagacagactttgaggtcctc
accaaagtcctgcaggaagagcccccgctcttgcccggacacatgggcttctcaggggac
ttccagtccttcgtcaaagactgccttactaaggatcacaggaagagaccaaagtataat
aagctacttgaacacagcttcatcaagcgctacgagatgctggaggtagacgtggcttcc
tggttcaaggatgtcatggcgaagactgagtcacctaggacgagcggagtcctgagccag
caccacctgcccttcttcaggtag

DBGET integrated database retrieval system