KEGG   Canis familiaris (dog): 485045Help
Entry
485045            CDS       T01007                                 

Gene name
SIRT6
Definition
(RefSeq) sirtuin 6
  KO
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
cfa  Canis familiaris (dog)
Pathway
Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    485045 (SIRT6)
Enzymes [BR:cfa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     485045 (SIRT6)
Chromosome [BR:cfa03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    SIRTs (sirtuins, class III HDACs)
     485045 (SIRT6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
20
AA seq 329 aa AA seqDB search
MSVNYAAGLSPYADKGKCGLPEIFDPPEELERKVWELAQLVWQSSNVVFHTGAGISTASG
IPDFRGPHGVWTMEERGLAPKFDTTFESARPTQTHMALVQLERVGLLRFLVSQNVDGLHV
RSGFPRDKLAELHGNMFVEECVKCKTGELRDTILDWEDALPDRDLTLADEASRNADLSIT
LGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRHADLRIHGYVDEVMTRLMKHLGLE
IPAWDGPRVLERALPPLPRPPAKPPEPEPKEEAPAQLNGPAPASPKQEPSTEPCTQHNGS
GPGSPKRERLDSPVPHRPPKRVKAEVAPS
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtgaattacgcggcgggactgtcgccgtacgcggacaagggcaagtgcggcctc
cccgagatcttcgacccgcctgaggagttggagcgcaaggtgtgggagctggcacagctg
gtctggcagtcctccaacgtggtgttccacacaggtgctggcatcagcaccgcctcgggc
atcccagacttcaggggcccccatggcgtctggacgatggaggagcggggcctggccccc
aaattcgacaccacctttgagagcgcgcggcccacgcagacccacatggcactggtgcag
ctggagcgcgtgggcctcctccgcttcctggtcagccagaatgtggatgggctgcatgtg
cgctccggtttccccagggacaagctggcggagctccacggaaacatgttcgtagaggaa
tgtgtcaagtgtaagacgggggagctgagggataccatcctggactgggaggacgccctg
cctgaccgggacctcactcttgccgacgaggccagcaggaacgcagacctgtccatcacg
ctgggcacctccctgcaaatccggcccagcgggaacctgccactcgccactaagcgccga
ggaggccgactggtcattgtcaaccttcagcccacaaagcacgaccgccatgccgacctg
cgcatccacggctatgtggatgaggtcatgaccaggcttatgaagcacctgggcctggag
atccctgcctgggacggtccccgcgtgctggagagagcgctgccacccctgccccgccca
cccgcaaagccccccgagcccgagcccaaggaggaggcgcccgcccagctcaatggccca
gcacccgccagtcccaagcaggagccctccacagagccctgcacccagcacaatggctct
gggcccggcagccccaagagggagcggctggacagtcctgtaccacacaggccccccaaa
agggtgaaggccgaggtggcccccagctga

DBGET integrated database retrieval system