KEGG   Canis familiaris (dog): 485168Help
Entry
485168            CDS       T01007                                 

Gene name
USP35
Definition
ubiquitin specific peptidase 35
Orthology
K11854  
ubiquitin carboxyl-terminal hydrolase 35/38 [EC:3.1.2.15]
Organism
cfa  Canis familiaris (dog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
21
AA seq 1007 aa AA seqDB search
MDKILEAVVTSSYPASVKQGLVRRVLEAARQPLEREQCLALLALGARLYVGGADELPRRV
GCQLLHVAGRHHPDVFAEFFSARRVLRLLQGGAGPPGARALACVQLGLQLLPEGPAADEV
FALLRREVLRTVCERPGPAACAQVARLLARHPRCVPDGPHRLLFCQQLVRCLGRFRCPAE
GEEGAVEFLEQAQQVSGLLAQLWRAQPAAILPCLKELFAVISCTEEEPPSSALASVVQHL
PLELMDGVVRNLSNDDSVTDSQMLTAISRMIDWVSWPLGKNIDKWIIALLKGLAAVKKFS
ILIEVSLAKIEKVFSKLLYPIVRGAALSVLKYMLLTFQHSHEAFHLLLPHIPPMVASLVK
EDSNSGTSCLEQLAELVHCMVFRFPGFPDLYEPVMEAIKDLHVPNEDRIKQLLGQDAWTS
QKSELAGFYPRLMAKSDTGKIGLINLGNTCYVNSVLQALFMASDFRHCVLRLTENNSQPL
MTKLQWLFAFLEHSQRPAISPENFLSASWTPWFSPGTQQDCSEYLKYLLDRLHEEEKTGT
RICQKLKQSSSPSPPEEPPSPSPTSVEKMFGGKIVTRIRCLRCLNVSSREEAFTDLSLAF
PPTERCRRRRLGSVMLPAEDVGVQDPPPPSQAQVPSRVGPRRQRKHCVTGDAPATVLDIE
SLGPQGPGTQSSGEKVEREEEAQEEERTREEEEEEEEKKEKEKEKEEEEEEEEKAEKVKE
VETTKEKEEDSSGQGSHRGAAPAAEGSRSVLDLVNYFLSPERLTAENRYYCEPCASLQDA
EKAVELSQGPRYLILTLLRFSFDLRTMRRRKILDDVSIPLLLRLPLAGGRGQAYDLCSVV
VHSGVSSESGHYYCYAREGAARPAPSLGAADRPEPENQWYLFNDTRVSFSSFESVSNVTS
FFPKDTAYVLFYRQRPGEAPEAEPSSPRGRTEPTLHKDLMEAISKDNILYLQEQEKEARS
RAAYISALPASPHWGRGFDEDKDEDEGSPGGCNPAGGNGGDFHRLVF
NT seq 3024 nt NT seq  +upstreamnt  +downstreamnt
atggacaagatcctggaggcggtggtgacgtcctcgtacccggcgagcgtgaagcagggg
ctggtgcggcgcgtgctggaggcggcgcggcagccgctggagcgcgagcagtgcctggcg
ctgctggcgctgggcgcgcgtctctacgtgggcggcgcggacgagctgccccgccgcgtg
ggctgccagctgctgcacgtggccggccgccaccaccccgacgtcttcgccgagttcttc
agcgcgcgccgcgtgcttcgcctgctgcagggcggcgccggccctccgggcgcccgcgcg
ctcgcctgcgtgcagctgggcctgcagctgttgcccgagggcccggcggccgacgaggtg
ttcgcgctgctgcggcgggaggtgctgcgcaccgtgtgcgagcgcccggggccggcggcc
tgcgcgcaggtggcgcggctgctggcgcgacacccgcgctgcgtccccgacgggcctcac
cgcctgctcttctgccagcagctggtgcgctgcctcggccgcttccgctgcccggcggag
ggcgaggagggcgccgtggagttcctggagcaggcccagcaggtgagcgggctcctggcg
cagttgtggcgcgcccagcccgccgccatcctaccctgcctgaaggagctgttcgccgtc
atctcctgcacagaggaagagccaccatccagtgccctggccagcgtggtccaacaccta
ccattggagcttatggatggtgtcgtccggaacctcagcaatgatgacagtgtgacagac
tctcagatgctgactgctattagcaggatgatcgactgggtgtcatggcccttggggaag
aacattgacaagtggatcattgcattgttgaagggcctggcagctgttaagaagttcagc
atcttgattgaggtttcacttgccaaaattgaaaaggttttctccaagcttctatacccc
attgtccggggagctgccttgtctgtcctcaagtacatgctcctgaccttccagcactcc
catgaggccttccacctgctcctccctcacatccccccaatggtggcctctctggtcaag
gaggactccaactctgggaccagctgcctggagcaactggcagaactggtccactgcatg
gtcttccggttcccaggcttcccggatctgtatgagcctgtcatggaggccattaaggac
ctccatgttcccaatgaggaccgcatcaagcagctgctggggcaggatgcctggacctcg
cagaagagtgagctggctggtttctatcctcggctcatggccaagtcagacacgggcaag
attggtttaatcaatctgggcaacacatgctacgtgaacagcgtccttcaggccttattc
atggcttctgacttcagacactgtgtactccgattgactgagaacaactcacagcctctt
atgaccaagctgcagtggctctttgccttcctggagcatagccagcggcctgccatctct
ccagaaaacttcctttctgcatcctggacaccctggtttagccccggcacccagcaggac
tgctcagagtacctgaagtacctgctggatcggctacacgaagaggagaaaactgggaca
aggatctgccaaaagctcaagcagtccagctcaccctcccctcccgaggagccccccagc
cccagtcccacctctgtggagaagatgttcggaggcaagatcgtgactcggatacgctgt
ctccgctgcctcaatgtctcctccagagaggaggccttcacagacctgtcccttgcattc
ccccctactgagcgctgtcgccgccgccgcctgggctcagtgatgctccctgcagaggat
gtcggggtccaggaccccccgccaccatcccaagcccaggttccaagcagggtgggtcct
cggaggcaaaggaaacattgtgtcacaggggatgcccctgctactgtcctggacattgaa
agcctgggcccccagggacctgggacgcagagcagtggggagaaggtggagagggaggag
gaagcacaggaggaggaaaggacccgggaggaggaggaggaggaagaggagaagaaggaa
aaagagaaggagaaggaggaggaggaggaggaggaagaaaaggcagagaaggtgaaagag
gtcgagaccacgaaggagaaagaagaggacagctcggggcaggggtcccaccggggtgcc
gcccccgccgcagagggctcccgctctgtcctggacctggtcaactatttcctttccccc
gagaggctgacggcggagaaccgctactactgcgagccctgtgcctcgctgcaggacgcc
gagaaggcggtggagctgagccaggggccgcgctacctcatcctgaccctgctgcgcttc
tccttcgacctgcgcaccatgcggcgccgcaagatcctggacgacgtctccatccccttg
ctgctgcgcctgccgctggcggggggccgcggccaggcctacgacctctgcagcgtggtc
gtgcactcgggagtgtcctccgagagcggccactactactgctatgcccgcgagggcgcc
gcccgcccggccccctctctgggtgctgccgacaggcccgagcccgagaaccagtggtat
ctgttcaacgacactcgggtgtccttctcctccttcgagtctgtcagcaacgtcacctcc
ttcttccccaaggacacggcctatgtgctcttttaccggcagcggcctggggaggcgccc
gaggctgagcccagctcccccagaggccggacggagcccaccctccacaaagacttgatg
gaggccatttccaaagacaacatcctgtacctgcaggagcaggagaaggaggcacgaagc
agggcggcctacatctctgcactccccgcatccccgcactggggcaggggcttcgatgaa
gacaaggatgaggacgaaggctctccgggcggctgcaatcccgcaggtggcaacggcggg
gacttccacagactggtcttctaa

DBGET integrated database retrieval system