KEGG   Canis familiaris (dog): 485214Help
Entry
485214            CDS       T01007                                 

Gene name
ART5
Definition
ADP-ribosyltransferase 5
Orthology
K00775  
NAD(P)-arginine ADP-ribosyltransferase [EC:2.4.2.31]
Organism
cfa  Canis familiaris (dog)
Brite
Enzymes [BR:cfa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     485214 (ART5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
21
AA seq 309 aa AA seqDB search
MMLAALLMALSYLGFHALWQAQAVPILPLGLAPDTFDDAYVGCTEEMEEKAGPLLKEEMA
RHALLRESWEAARGAWEHKRQGLTLPPGFKAQHGIAIMVYTNSSNTLYWELNQAVRTGGG
SRESYMRHFPFKALHFYLTRALQLLQGSGGCSRGPGEVVFRGVGTLHFEPKRLGDSVRLG
QFASSSLDEAVARRFGNATFFSLRTCFGAPIQALSVFPEEREVLIPPHEVFLVTRFSQDG
ARSLVTLWSYNQTCSHFNCAYLGGEKRRRCVSVPTGGHPDSTSKKDFSLLSWKTLLLAPG
GFQLSGAGP
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgatgctggcggctctgctgatggctcttagctacctcggcttccatgccctctggcag
gcccaggctgttcccatcctgcccctgggcctggctccagacactttcgatgatgcttat
gtgggctgcacagaggagatggaagagaaagcaggccctctgctgaaggaggagatggcc
cgccatgccctgctgcgagagtcctgggaggcagcccggggggcctgggagcacaagcgc
caagggctcaccctgccccctggcttcaaagcccagcatggaatcgccatcatggtctat
accaactcatctaacactttgtactgggagctgaaccaggctgtgcggacaggtggtggc
tcccgggagtcctacatgaggcactttcccttcaaggctctgcatttctacctcacccgg
gccctgcagctgctgcagggcagtggaggctgcagccggggacctggggaggtggtgttc
cgaggtgtgggcactcttcactttgaacccaagaggcttggggactctgtccgcttgggc
cagtttgcttccagctccctggatgaggcagtggcccgcagatttggcaacgccaccttc
ttctctctaaggacttgctttggggcccctatccaggccttgtctgtctttcctgaggag
cgcgaggtgctgatccctccacatgaagtcttcttggtcaccaggttctcccaggatgga
gcccggagcctggtgaccctctggagctataatcagacctgcagtcactttaactgcgcc
tatctgggtggggagaagaggcggaggtgtgtgtctgtaccaacaggagggcacccggac
tccacctccaagaaggacttctctctgctttcctggaagaccctgctcttggcccccggg
ggcttccagctctcaggagctgggccatga

DBGET integrated database retrieval system