KEGG   Canis familiaris (dog): 485367Help
Entry
485367            CDS       T01007                                 

Gene name
CYB5R2
Definition
(RefSeq) cytochrome b5 reductase 2
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    485367 (CYB5R2)
Enzymes [BR:cfa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     485367 (CYB5R2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_6 NAD_binding_1 NAD_binding_6 YiiD_C
Motif
Other DBs
NCBI-GeneID: 485367
NCBI-ProteinID: XP_542485
Ensembl: ENSCAFG00000006769
UniProt: F1PJ51
Position
21
AA seq 304 aa AA seqDB search
MFGVSLRDPSLLLAITVIGVTVVLLALRNMNSRRKQITLQDSEAKYLLPLIEKEQISHNT
WRFRFGLPSSDHVLGLPIGNYVHLLAKIDGVMVVRAYTPVSSDDDRGFVDLIIKVYFKNV
HPNYPEGGKMTQYLENMKIGDTILFRGPTGRLFYNGPGNFSIKPYKTSEPEKKLVSHLGM
IAGGTGITPMLQLIRHITKNPNDRTRMSLIFANQTEEDILVRRELEEVARTHPDQFDLWY
TLDRPPVGWKYSSGYITANMIKEHLPPPGQSTLILVCGPMPLIQTAAHPNLEKLGYTKEM
IFTY
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgttcggcgtctccctccgggacccatccttgctccttgccatcactgtcattggggtc
acagtggtcctgttggctctgaggaacatgaactcaaggaggaaacagatcaccttacag
gactctgaagccaagtacctgctgcccttgattgagaaggagcaaatcagccacaacacc
tggaggttccgttttgggctgccctcatcagaccatgtcttggggcttcctataggtaac
tatgtccatctcttggccaaaattgatggcgttatggtggtcagggcttacacgcctgtg
tccagtgatgatgaccgaggctttgtggacttgattataaaggtctacttcaaaaatgtg
caccccaattatccagaaggggggaagatgactcagtacttggagaacatgaaaatcggg
gacaccatcctttttcgagggccaactggtcgcctcttctataatgggccagggaacttt
tcaatcaagccatacaaaacaagtgagcctgaaaagaagctggtcagtcacctgggaatg
attgctgggggcacagggatcacgcccatgctgcagctcattcgccacatcaccaagaac
cccaacgacaggaccaggatgtccctcatctttgccaaccagacagaggaggatatcttg
gtgagacgggagcttgaagaagttgccagaactcacccggaccagtttgacctgtggtac
accctggacaggcctcctgttggctggaagtacagctcaggctacatcaccgccaacatg
atcaaggagcacctccctcctccggggcagtccacgctcatcctggtgtgtggcccaatg
cccctgatccagacagctgctcatcctaacctggagaaactgggttataccaaggagatg
attttcacttactaa

DBGET integrated database retrieval system