KEGG   Canis familiaris (dog): 485409Help
Entry
485409            CDS       T01007                                 

Gene name
PTPN5
Definition
protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched)
Orthology
K18018  
tyrosine-protein phosphatase non-receptor type 5 [EC:3.1.3.48]
Organism
cfa  Canis familiaris (dog)
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    485409 (PTPN5)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     485409 (PTPN5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
21
AA seq 589 aa AA seqDB search
MRGGPTGREPSVLFAEELPALAPDGAFPHPDTLGMNYEEARSEREKHAADDSEGGILDMC
CSERLPGLPQPVVMDTLDQAEGLAGPQREMPPPPPPPPPPRGPGSHSLGGRSGLCLLAAS
QLLLACGVLWLSGYGPIWSQNATDVLSSSLTLLEQLGPTARLGVGTLEVPNLLLVTLSVI
LITTLVWHLLRAPPEPSTPLPPEDRRQSVSRQPSFTYSEWMEEKVEDDFLDLDPVPETPV
FDCVMDIKPEADPASLTVKSMGLQERRGSNVSLTLDMCTPGCGEEGFGYLMSPREESARE
YLLSASRVLQAEELHEKALDPFLLQAEFFEIPMNFVDPKEYDIPGLVRKNRYKTILPNPH
SRVCLTSPDPDDPLSSYINANYIRGYGGEEKVYIATQGPIVSTVGDFWRMVWQEHTPIIV
MITNIEEMNEKCTEYWPEEQVVYDGVEIIVQKVIHTEDYRLRVISLRNGTEERGLKHYWF
TSWPDQKTPDRAPPLLHLVREVEEAAQQEGPRCAPIIVHCSAGIGRTGCFIATSICCQQL
RHEGVVDILKTTCQLRQDRGGMIQTCEQYQFVHHVMSLYEKQLSRPSPE
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgaggggaggacccactggcagggagcccagtgtgctttttgctgaagagcttcctgcc
ctggctcccgatggcgcctttccccatccagacaccttgggaatgaattatgaggaagcc
aggagtgagagagagaagcacgcggccgatgactccgagggagggatcctggacatgtgc
tgcagtgagaggctgccgggtctgccccagccggtagtgatggacacgctggaccaggcc
gaagggctcgcgggcccgcagcgagagatgccgccgcccccgccgcccccgccgccaccc
cgaggccccggcagccactccctcggcggcaggagcggcctgtgcctgttggctgcctct
cagctcctgcttgcctgcggggtcctctggctcagcggctacggccccatctggtcacag
aatgccacagacgtcctgtcgtcctcgctcacactcctggaacagctgggacccacggcc
cggctgggcgttgggaccttggaggtccccaatctgctgctggttactctgtctgtgatc
ctcattaccaccctggtgtggcacctcctgagggctcccccagagccatccaccccactg
ccccctgaggataggcgccagtcagtgagccgtcaaccctccttcacctactcagagtgg
atggaagagaaggtcgaggatgacttcctggacctggaccctgtccctgagactcctgtg
tttgactgcgtgatggacatcaagcctgaggctgaccctgcctcactgaccgtcaagtcc
atgggtctacaggaaaggaggggctccaacgtctccctgaccctggacatgtgcacgcca
ggctgcggtgaggagggctttggctacctcatgtccccgcgtgaggagtcggcccgcgag
tacctgctcagcgcctcccgggtcctgcaggccgaggagcttcacgagaaggccctggac
cccttcctgctgcaggcagagttctttgaaatccccatgaactttgtggatccgaaggag
tatgacatccccgggctggtgcgcaagaaccggtacaaaaccatcctgcccaacccccac
agcagagtgtgtctgacctcaccagaccctgatgaccctctgagttcctacatcaacgcc
aactacatccggggctacggcggggaggagaaggtgtacatcgccactcagggacccatc
gtcagcacagtcggtgacttctggcgcatggtgtggcaggagcacacgcccatcatcgtc
atgatcaccaacatcgaggagatgaacgagaagtgcactgagtattggccggaggagcag
gtggtgtacgacggtgtggagatcatcgtgcagaaggtcattcatactgaggattaccgg
ctgcgagtcatctccctcaggaacgggaccgaagagcgaggcctgaagcattactggttc
acgtcctggcctgaccagaagaccccagaccgggctcccccactcctgcacctggtccgg
gaggtggaggaggcagcccagcaggaggggccgcgctgtgcccccatcatcgtccactgc
agtgcagggattggcaggacaggctgcttcattgccaccagcatctgctgccagcagctg
cggcatgagggagtggtggacatccttaagaccacgtgccagctccgtcaggacaggggc
ggcatgatccagacgtgtgagcaataccagtttgtgcaccatgtcatgagcctctacgag
aagcagctgtcccgcccgtccccagagtga

DBGET integrated database retrieval system