KEGG   Canis familiaris (dog): 485441Help
Entry
485441            CDS       T01007                                 

Gene name
SETDB2
Definition
SET domain, bifurcated 2
Orthology
K18494  
histone-lysine N-methyltransferase SETDB2 [EC:2.1.1.43]
Organism
cfa  Canis familiaris (dog)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    485441 (SETDB2)
Enzymes [BR:cfa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     485441 (SETDB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
22
AA seq 705 aa AA seqDB search
MGEKNGDAKTFWMDLEDDGKVDFIFEQVQNVLQSLKQKIKDGSATNKEYIQAMILVNEAT
ISNNSTLIKDHISVTQNEQENKSGSLPSTSYEDSFPEDCTSLSAKNKEIPPLENKVAYIR
EKKSFFNLPYRSHDCSRTCLMKTPLTFKGENPLQLPIKCHFQRRHAKTNSHSSALHVSYK
TPCGRSLRNVEEVFRYLLETECNYLFTDNFSFNTYVQLTRNYPKQEEIVSDVDISNGVES
VPISFCNEIDNRKLPHFKYRRTVWPRAYYLTSFSNMFTDSCDCSEGCIDITKCACLQLTA
RNAKTCPLSSNKITTGYKYKRLQRQIPSGIYECSLLCKCNRRICQNRVVQHGPQVRLQVF
KTEKKGWGVRCLDDIDRGTFVCIYSGRLLSRSNVEKPGAATDENGKDYIMKNMFSKKRKI
EVADCEVEVIPLDLETHNRSAATEECPPVFNNNIKEPVTDMKCNSISRIQYHSVIRSPKV
KTVIIQRNGKRMGFASSESVTSEDNDGFKPTQVHLNSNTKEMKKDSSSYQVKDSEDNLLI
ESDVIDITKCREESPSGGRCNQATTLDKQNIIKEFKAQVQKPQEERSPAYRNHQVFCDKE
FPSEAKNISPNSLKKFSKGNVFLLDATKEGNVGRFLNHSCCPNLLVQNVFVETRDRNFPL
VAFFTNRHVKARTELTWDYGYEAGTMPEKEILCQCGVNKCRKKIL
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgggagaaaaaaatggtgatgcaaaaactttctggatggatctggaagatgatggaaaa
gtggacttcatatttgaacaagtgcaaaatgtgctgcaatcactgaaacaaaagatcaaa
gatgggtctgccacaaataaagaatatattcaagcaatgattctagtgaatgaagcaacc
ataagtaacaattccacattgataaaggatcatatatctgtgactcagaatgaacaggaa
aataaatcaggttcattgccctctacatcatatgaagactcctttccagaagactgtaca
tctctatctgcaaaaaataaggaaattcctcctttggaaaataaagttgcctacattaga
gaaaagaaatcattttttaatctaccttaccgaagtcatgactgctctcgaacttgtctg
atgaaaacaccactgaccttcaagggagaaaaccctctgcagctaccaatcaaatgccac
ttccaaagacgacatgcaaagacaaactctcattcttcagcactccatgtgagttataaa
accccttgtggaaggagtctacgaaacgtggaagaagtttttcgttacctgcttgagaca
gagtgcaactatttatttacagataatttttctttcaatacctatgttcagttgactcgg
aattacccaaaacaagaagaaattgtttctgatgtggatataagcaatggagtggaatcg
gtacccatttctttctgtaatgaaattgacaatagaaagcttccacattttaagtacaga
aggactgtgtggccacgtgcatattatctaaccagcttttccaacatgtttactgattca
tgtgactgttctgagggctgcatagacataacaaaatgcgcatgtcttcaattgacagca
aggaatgccaagacttgccccttgtcaagtaataaaataaccactggatataaatataaa
agactacagagacaaataccttctggcatttatgaatgcagcctgttgtgcaagtgtaat
agacggatatgtcaaaatcgagttgtccagcatggacctcaagtgaggctacaggtgttc
aaaactgagaaaaagggatggggagtacgctgcctagatgacattgacagagggacattt
gtttgcatttattcaggaagattattaagcagatctaatgtggagaaacctggtgctgct
actgatgaaaacggaaaagattatattatgaaaaatatgttttcaaaaaagaggaaaata
gaagttgcagattgtgaggttgaagttatcccattagacctggaaacacataatagaagt
gctgcgactgaggagtgtccacctgtattcaataataatataaaagagcctgttacagat
atgaaatgtaacagtatttcaagaattcaatatcattcagtcattagaagtcctaaagtg
aagacagtcattattcagcgcaatgggaaaaggatgggatttgcttcctcagagtctgtc
acctcagaagataatgatggatttaaaccaactcaagtacatctgaactccaataccaag
gaaatgaaaaaggattcaagctcctaccaagttaaagactctgaagacaatctgctgatt
gaatcagatgtgatagatataactaaatgtagagaagaatctccatcagggggcagatgt
aaccaagcaaccacactggataaacaaaatattataaaggagttcaaagctcaagtgcaa
aagccccaagaggaaagatctccagcgtatcgaaatcatcaggtcttttgtgataaagag
ttcccaagtgaagccaagaatatttcacctaattccctaaagaagttcagtaaagggaat
gtgtttttattggatgccacaaaagaagggaatgtgggccgcttccttaatcatagttgt
tgcccaaatcttttggtacagaatgtttttgtagaaacacgtgacagaaattttccattg
gtggcgttcttcaccaacaggcatgtgaaagcaagaacagaactaacatgggattatggg
tatgaagctgggactatgcctgaaaaagaaatcctctgccaatgtggggttaacaagtgt
agaaagaaaatattataa

DBGET integrated database retrieval system