KEGG   Canis familiaris (dog): 485441Help
Entry
485441            CDS       T01007                                 

Gene name
SETDB2
Definition
(RefSeq) SET domain bifurcated 2
  KO
K18494  
histone-lysine N-methyltransferase SETDB2 [EC:2.1.1.43]
Organism
cfa  Canis familiaris (dog)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    485441 (SETDB2)
Enzymes [BR:cfa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     485441 (SETDB2)
Chromosome [BR:cfa03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     485441 (SETDB2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    485441 (SETDB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
22
AA seq 705 aa AA seqDB search
MGEKNGDAKTFWMDLEDDGKVDFIFEQVQNVLQSLKQKIKDGSATNKEYIQAMILVNEAT
ISNNSTLIKDHISVTQNEQENKSGSLPSTSYEDSFPEDCTSLSAKNKEIPPLENKVAYIR
EKKSFFNLPYRSHDCSRTCLMKTPLTFKGENPLQLPIKCHFQRRHAKTNSHSSALHVSYK
TPCGRSLRNVEEVFRYLLETECNYLFTDNFSFNTYVQLTRNYPKQEEIVSDVDISNGVES
VPISFCNEIDNRKLPHFKYRRTVWPRAYYLTSFSNMFTDSCDCSEGCIDITKCACLQLTA
RNAKTCPLSSNKITTGYKYKRLQRQIPSGIYECSLLCKCNRRICQNRVVQHGPQVRLQVF
KTEKKGWGVRCLDDIDRGTFVCIYSGRLLSRSNVEKPGAATDENGKDYIMKNMFSKKRKI
EVADCEVEVIPLDLETHNRSAATEECPPVFNNNIKEPVTDMKCNSISRIQYHSVIRSPKV
KTVIIQRNGKRMGFASSESVTSEDNDGFKPTQVHLNSNTKEMKKDSSSYQVKDSEDNLLI
ESDVIDITKCREESPSGGRCNQATTLDKQNIIKEFKAQVQKPQEERSPAYRNHQVFCDKE
FPSEAKNISPNSLKKFSKGNVFLLDATKEGNVGRFLNHSCCPNLLVQNVFVETRDRNFPL
VAFFTNRHVKARTELTWDYGYEAGTMPEKEILCQCGVNKCRKKIL
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgggagaaaaaaatggtgatgcaaaaactttctggatggatctggaagatgatggaaaa
gtggacttcatatttgaacaagtgcaaaatgtgctgcaatcactgaaacaaaagatcaaa
gatgggtctgccacaaataaagaatatattcaagcaatgattctagtgaatgaagcaacc
ataagtaacaattccacattgataaaggatcatatatctgtgactcagaatgaacaggaa
aataaatcaggttcattgccctctacatcatatgaagactcctttccagaagactgtaca
tctctatctgcaaaaaataaggaaattcctcctttggaaaataaagttgcctacattaga
gaaaagaaatcattttttaatctaccttaccgaagtcatgactgctctcgaacttgtctg
atgaaaacaccactgaccttcaagggagaaaaccctctgcagctaccaatcaaatgccac
ttccaaagacgacatgcaaagacaaactctcattcttcagcactccatgtgagttataaa
accccttgtggaaggagtctacgaaacgtggaagaagtttttcgttacctgcttgagaca
gagtgcaactatttatttacagataatttttctttcaatacctatgttcagttgactcgg
aattacccaaaacaagaagaaattgtttctgatgtggatataagcaatggagtggaatcg
gtacccatttctttctgtaatgaaattgacaatagaaagcttccacattttaagtacaga
aggactgtgtggccacgtgcatattatctaaccagcttttccaacatgtttactgattca
tgtgactgttctgagggctgcatagacataacaaaatgcgcatgtcttcaattgacagca
aggaatgccaagacttgccccttgtcaagtaataaaataaccactggatataaatataaa
agactacagagacaaataccttctggcatttatgaatgcagcctgttgtgcaagtgtaat
agacggatatgtcaaaatcgagttgtccagcatggacctcaagtgaggctacaggtgttc
aaaactgagaaaaagggatggggagtacgctgcctagatgacattgacagagggacattt
gtttgcatttattcaggaagattattaagcagatctaatgtggagaaacctggtgctgct
actgatgaaaacggaaaagattatattatgaaaaatatgttttcaaaaaagaggaaaata
gaagttgcagattgtgaggttgaagttatcccattagacctggaaacacataatagaagt
gctgcgactgaggagtgtccacctgtattcaataataatataaaagagcctgttacagat
atgaaatgtaacagtatttcaagaattcaatatcattcagtcattagaagtcctaaagtg
aagacagtcattattcagcgcaatgggaaaaggatgggatttgcttcctcagagtctgtc
acctcagaagataatgatggatttaaaccaactcaagtacatctgaactccaataccaag
gaaatgaaaaaggattcaagctcctaccaagttaaagactctgaagacaatctgctgatt
gaatcagatgtgatagatataactaaatgtagagaagaatctccatcagggggcagatgt
aaccaagcaaccacactggataaacaaaatattataaaggagttcaaagctcaagtgcaa
aagccccaagaggaaagatctccagcgtatcgaaatcatcaggtcttttgtgataaagag
ttcccaagtgaagccaagaatatttcacctaattccctaaagaagttcagtaaagggaat
gtgtttttattggatgccacaaaagaagggaatgtgggccgcttccttaatcatagttgt
tgcccaaatcttttggtacagaatgtttttgtagaaacacgtgacagaaattttccattg
gtggcgttcttcaccaacaggcatgtgaaagcaagaacagaactaacatgggattatggg
tatgaagctgggactatgcctgaaaaagaaatcctctgccaatgtggggttaacaagtgt
agaaagaaaatattataa

DBGET integrated database retrieval system