KEGG   Canis familiaris (dog): 485586Help
Entry
485586            CDS       T01007                                 

Gene name
PLCD1
Definition
phospholipase C, delta 1
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
cfa  Canis familiaris (dog)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Thyroid hormone signaling pathway
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    485586 (PLCD1)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    485586 (PLCD1)
   04070 Phosphatidylinositol signaling system
    485586 (PLCD1)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    485586 (PLCD1)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     485586 (PLCD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
23
AA seq 777 aa AA seqDB search
MQCLGIPSRSRSRERYLQEESLKVAALNGQRLGLQHDEDLHALLKGSQLLKVKSNSWRRE
RFYKLQEDCKTIWQESRKVMRTPESQLFSIEDIQEVRKGHRTEGLEKFARDVPEDRCFSI
VFKDQRNTLDLIAPSPAEAQHWVQGLRKIIHHSGSMDQRQKLQHWIHSCLRKADKNKDNK
MSFKELQNFLKELNIQVDDSYARKIFRECDHSQTDSLEDDEIEAFYKMLTQRAEIDRTFA
EAAGSGETLSVDQLVSFLQHQQREEAAGPALALSLIERYEPSETAKAQRQMTKDGFLMYL
LSADGSAFSLAHRRVYQDMGQPLSHYLMSSSHNTYLLEDQLTGPSSTEAYIRALCKGCRC
LELDCWDGPNQEPIIYHGYTFTSKILLCDVLRAIRDYAFKASPYPVILSLENHCSLEQQR
VMARHLRTILGPMLLDRPLDGVTTSLPSPEQLKGKILLKGKKLGGLLPPGGEGGPEATVV
SEEDEAAEMEDEAVRSRVQRKPREDKLRLVKELSDMVIYCKSVHFGGFSGPGTSGQAFYE
MVSFSENRALRLLQESGNSFVRHNVNHLSRIYPAGWRTDSSNYSPVEMWNGGCQIVALNF
QTPGPEMDVYQGRFQDNGACGYVLKPAFLRDLNSTFNSRALAQGPWWTRKRLSIRVISGQ
QLPKVNKNKNSIVDPKVTVEIHGVGRDMASRQTAVVTNNGFNPWWDTEFEFEVAVPELAL
VRFVVEDYDASSKNDFIGQSTIPLGSLKQGYRHVHLLSKNGDQHPSATLFVKVSLQD
NT seq 2334 nt NT seq  +upstreamnt  +downstreamnt
atgcagtgcctgggaatcccgagccgcagccgctccagagagcgttacctgcaggaggag
agcctcaaggtggccgcgctcaatgggcagaggctaggtctccagcacgatgaggaccta
catgcactgctgaagggcagccagctcctgaaggtgaaatccaactcatggcggagagag
cgtttctacaagttgcaggaagactgcaagaccatctggcaggagtcccgtaaggtcatg
cggaccccagagtcccagctgttctccattgaggacattcaggaggtgcggaagggccac
cgcacggagggcctggagaagtttgcccgggatgtgcccgaggaccgctgcttctccatt
gtcttcaaggaccagcgcaatacactagacctcatcgccccatcgccagctgaggcccag
cattgggtgcagggtctgcgtaagatcatccaccactcgggctccatggaccagaggcag
aagctgcagcactggattcactcctgcttgcgaaaagctgacaaaaacaaggacaacaag
atgagcttcaaggagctgcagaacttcctgaaggaactcaacatccaggtggatgacagc
tatgcccgcaagatcttcagggaatgtgaccactcccagacggactccctggaggacgat
gagattgaggccttctacaagatgctgacccagcgggcggagattgaccgcaccttcgct
gaggcggcgggctctggggagacactgtccgtggaccagttagtaagcttcctgcagcac
cagcagcgggaagaggcggcagggcctgccctggcgctctccctcattgagcgctatgag
cccagtgagactgccaaggcgcagcggcagatgaccaaggacggcttcctcatgtacctg
ctgtccgccgacggcagcgccttcagcctggcgcaccggcgggtctaccaggacatgggc
cagccgctcagccactacctgatgtcctcctcgcacaacacctacctgctggaagaccag
ctcacggggcccagcagcaccgaggcctacatacgggcgctgtgcaagggctgccgctgc
ctggagctcgactgctgggacggccccaaccaggagcccatcatctaccatggctacact
ttcacctccaagatcctcctctgcgacgtgctcagggccatccgggactacgccttcaag
gcgtccccgtaccccgtcatcctgtccctggagaaccactgcagcctggagcagcagcgg
gtgatggcgcgacacctgcgcaccatcctgggccccatgctgttggaccggccgctggac
ggggtcaccaccagtctgccttcccctgagcaactgaaggggaagatcttgctgaagggg
aagaagcttgggggcctcctgccccctggcggggagggcggccctgaagccactgttgtg
tctgaggaggatgaggctgctgagatggaggacgaggccgtgaggagccgagtgcagcgc
aagcccagggaggacaagctcaggctagtgaaggagctctcggatatggtcatttactgc
aagagtgtccactttgggggcttctccggccctggcacctcagggcaggccttctatgag
atggtgtccttctctgagaaccgcgccctccgactgctccaagaatcaggaaacagcttt
gttcgccacaacgtcaatcacctgagcaggatctaccctgctggctggagaacggactcc
tccaactacagccctgtggagatgtggaacgggggctgccagatagtggccctgaatttc
cagacacctggcccggagatggacgtgtaccagggccgcttccaggacaacggggcctgt
gggtatgtgctgaagcctgccttcctgcgagacctgaactctacctttaactcacgtgcc
ctggctcaggggccctggtggaccaggaagcggcttagcatcagggtcatctctggacag
cagttgccaaaagtcaacaagaataagaattcaatagtggaccccaaggtgacggtggag
atccatggtgtgggccgcgacatggccagccgccagactgctgtcgtcaccaataatggt
ttcaacccgtggtgggacacagagttcgagtttgaggtggccgtgcctgagctcgccctc
gtgcgctttgtggtggaggattatgacgcatcctctaagaacgactttattggccagagc
accatccccttgggcagcctcaagcaaggataccgccatgtccacctcttgtcaaagaac
ggagaccagcacccatctgccaccctctttgtgaaggtgtctctccaggactag

DBGET integrated database retrieval system