KEGG   Canis familiaris (dog): 485940Help
Entry
485940            CDS       T01007                                 

Gene name
AURKA
Definition
(RefSeq) aurora kinase A
  KO
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
cfa  Canis familiaris (dog)
Pathway
Oocyte meiosis
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    485940 (AURKA)
Enzymes [BR:cfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     485940 (AURKA)
Protein kinases [BR:cfa01001]
 Serine/threonine protein kinases: Other group
  Aur family [OT]
   485940 (AURKA)
Protein phosphatases and associated proteins [BR:cfa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     485940 (AURKA)
Chromosome [BR:cfa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    485940 (AURKA)
   Spindle formation proteins
    485940 (AURKA)
  Sister chromatid separation proteins
   Aurora kinases
    485940 (AURKA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
24
AA seq 405 aa AA seqDB search
MDKSKENCIAGPVKTAIALGDGPKRVLVTQQVPSQNPLSANSGQAQRVLCPSNSSQRVPP
QTQKLVSSHKPAQNLKQKQLQATGVPRPASRSLNNTQKSEQPSSSAPGNNSEKELATKQK
NEESKKRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILAIKVLFKAQLEKAGVEHQLR
REVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGAVYRELQKLSKFDEQRTATYITE
LADALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAPSSRRTTLCGTLDYLPPE
MIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEASTYQETYKRISRVEFTFPDFVPEGARDL
ISRLLKHNPSQRPTLKDVLEHPWIMANSSKPSSSQKNKDSTSKQS
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggacaaatctaaagaaaactgcattgcagggcctgttaagactgcaattgcacttggt
gatggtccaaaacgtgttctggtgactcagcaagttccttcacagaatccattatctgca
aatagtggccaggcccagcgggtcttgtgtccttcaaattcttcccagcgagttcctcca
caaacccaaaagctcgtctccagccataaaccggctcagaatctgaagcagaagcaattg
caggcaactggtgtccctcgtcctgcctctaggtcactgaataatacccaaaagagtgag
caaccctcgtcatcagcccctggaaataattctgaaaaggaactggcaacaaaacagaaa
aatgaagaatcaaaaaaaaggcaatgggctttggaagattttgaaattggtcgcccactg
ggtaaaggaaagtttggtaatgtttacttggcaagggaaaaacaaagcaagtttatcctg
gctattaaagtattatttaaagctcaactggagaaagcaggagttgaacatcagctgaga
agagaagtagaaatacagtcccaccttaggcatccaaatattcttaggctgtatggttat
ttccatgatgccaccagagtttacctaattctagaatatgcacctcttggagctgtctac
agagaacttcagaaactgtcaaagtttgatgagcagagaactgctacttatatcacagag
ttggcagatgccctgtcttactgtcactcaaagagagtcattcacagagacattaagcca
gagaacctactccttggatcagctggagagcttaagattgcagattttgggtggtcagta
catgctccatcctccaggagaaccaccctgtgtggcaccctggattacttgcccccagag
atgattgaaggccgaatgcatgatgagaaggtggatctctggagccttggggttctttgc
tatgaatttctagttgggaagcctccttttgaggcaagcacataccaagagacctacaaa
agaatatcacgggttgaattcacattccctgacttcgtgccggagggagccagggatctc
atttcaagactgttgaaacataatcccagccaaaggccaactctcaaggatgtacttgaa
cacccgtggatcatggctaactcatcaaaaccatcaagtagccaaaaaaacaaagactca
actagcaaacagtcttaa

DBGET integrated database retrieval system