KEGG   Canis familiaris (dog): 485942Help
Entry
485942            CDS       T01007                                 

Gene name
RAE1
Definition
ribonucleic acid export 1
Orthology
K14298  
mRNA export factor
Organism
cfa  Canis familiaris (dog)
Pathway
RNA transport
Influenza A
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    485942 (RAE1)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    485942 (RAE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
24
AA seq 368 aa AA seqDB search
MSLFGTTSGFGTSGTSMFGSTSTDNHNPMKDIEVTSSPDDSIGCLSFSPPTLPGNFLIAG
SWANDVRCWEVQDSGQTIPKAQQMHTGPVLDVCWSDDGSKVFTASCDKTAKMWDLNSNQA
IQIAQHDAPVKTIHWIKAPNYSCVMTGSWDKTLKFWDTRSSNPMMVLQLPERCYCADVIY
PMAVVATAERGLIVYQLENQPSEFRRIESPLKHQHRCVAIFKDKQNKPTGFALGSIEGRV
AIHYINPPNPAKDNFTFKCHRSNGTNTSAPQDIYAVNGIAFHPVHGTLATVGSDGRFSFW
DKDARTKLKTSEQLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAE
ELKPRNKK
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgtttggaacaacctcgggttttggaactagtgggaccagcatgtttggcagc
acaagcacagataaccacaaccctatgaaggatattgaagtaacatcctcccccgatgac
agcattggttgtctatcttttagcccaccaaccttgcctgggaactttcttattgcagga
tcatgggctaatgatgttcgctgctgggaagttcaggacagtggacagactattccaaaa
gcccagcagatgcacacggggcctgtgttagatgtctgctggagtgatgatgggagcaaa
gtatttacagcatcatgtgataaaactgccaaaatgtgggacctcaatagtaatcaagca
atacagattgcacagcatgatgctcctgttaaaaccatacattggatcaaagcaccaaac
tacagctgtgtgatgaccgggagttgggataagactttgaagttttgggatacccgatca
tcaaatcctatgatggttttgcagctccctgaaagatgttactgtgctgacgtgatctac
cctatggccgtggtggcaactgcggagagaggactgattgtctaccaattagagaatcaa
ccttctgaattcaggaggatagagtctccgctgaaacatcagcatcgatgcgtggcaatt
tttaaagacaaacagaacaagccgactggttttgccctgggaagcatcgaggggagggtg
gctattcactacatcaaccctcccaatcctgccaaagataactttaccttcaaatgtcac
cgctcgaacggaaccaatacctcagctcctcaggacatctacgcggtaaatgggatcgcg
ttccatcctgtccatggcacccttgcaactgtgggatctgatggtagattcagcttttgg
gacaaagatgccagaacaaaactaaaaacttcagaacagttagatcaacccatatcagct
tgctgcttcaatcacaatggaaacatatttgcctatgcttccagctacgactggtccaag
ggacatgagttttataatccccaaaagaaaaactacattttcctgcgtaatgcggctgaa
gagctaaaacccaggaataagaagtag

DBGET integrated database retrieval system