KEGG   Canis familiaris (dog): 486033Help
Entry
486033            CDS       T01007                                 

Gene name
USP12, USP12P1
Definition
ubiquitin specific peptidase 12
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.1.2.15]
Organism
cfa  Canis familiaris (dog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
25
AA seq 370 aa AA seqDB search
MEILMTVSKFASICTMGANASALEKEIGPEQFPVNEHYFGLVNFGNTCYCNSVLQALYFC
RPFREKVLAYKSQPRKKENLLTCLADLFHSIATQKKKVGVIPPKKFITRLRKENELFDNY
MQQDAHEFLNYLLNTIADILQEERKQEKQNGRLPNGNIDSENNNSTPDPTWVHEIFQGTL
TNETRCLTCETISSKDEDFLDLSVDVEQNTSITHCLRGFSNTETLCSEYKYYCEECRSKQ
EAHKRMKVKKLPMILALHLKRFKYMDQLHRYTKLSYRVVFPLELRLFNTSGDATNPDRMY
DLVAVVVHCGSGPNRGHYIAIVKSHEFWLLFDDDIVEKIDAQAIEEFYGLTSDISKNSES
GYILFYQSRD
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcctaatgacagtctccaaattcgcctccatctgtaccatgggcgccaatgcc
tcggcattagagaaagagattggtccagaacagtttccagtcaatgagcactattttgga
ttagtcaattttgggaatacctgctactgtaattcagttcttcaagcactttatttttgt
cgtccatttcgggaaaaagttctagcgtacaagagccaacctaggaagaaggagaacctt
cttacctgcctagcagacctcttccatagtatagcgactcagaagaagaaggttggggtg
attcctcctaagaagttcataacaagattacggaaggaaaatgaactttttgacaactac
atgcaacaagatgcccatgaattcttaaattaccttctaaatacaattgccgatatttta
caagaagagagaaagcaagaaaaacaaaatggccgtttacctaacggtaatattgacagt
gagaacaacaacagcacaccagacccaacgtgggttcatgagatttttcagggaacattg
acaaatgaaacccgatgtcttacttgtgaaactataagcagcaaagatgaagatttttta
gacctttctgttgacgtggaacaaaacacatcgatcactcactgcttaaggggttttagc
aacacagaaactctgtgcagtgaatacaaatattactgtgaagaatgtcgcagcaaacag
gaagcacacaaacggatgaaagttaaaaaactgcccatgattctagctctgcacctgaag
aggtttaaatacatggatcaacttcatcgatacacaaaactgtcttaccgggtagttttt
cctttagaacttcgtctgtttaacacctctggcgatgcaaccaatcctgacagaatgtac
gaccttgttgctgtggtggttcactgtggaagtggtcccaatcgaggtcattatattgca
atagttaagagtcatgagttttggttgttgtttgatgacgacattgtagaaaaaatagat
gcacaagctattgaagaattctacgggttgacatcagatatctcaaagaactctgagtct
ggttacatccttttctatcagtctcgggactga

DBGET integrated database retrieval system