KEGG   Canis familiaris (dog): 486033Help
Entry
486033            CDS       T01007                                 

Gene name
USP12, USP12P1
Definition
(RefSeq) ubiquitin specific peptidase 12
  KO
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.4.19.12]
Organism
cfa  Canis familiaris (dog)
Brite
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     486033 (USP12)
Peptidases [BR:cfa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   486033 (USP12)
Ubiquitin system [BR:cfa04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    486033 (USP12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
25
AA seq 250 aa AA seqDB search
MQQDAHEFLNYLLNTIADILQEERKQEKQNGRLPNGNIDSENNNSTPDPTWVHEIFQGTL
TNETRCLTCETISSKDEDFLDLSVDVEQNTSITHCLRGFSNTETLCSEYKYYCEECRSKQ
EAHKRMKVKKLPMILALHLKRFKYMDQLHRYTKLSYRVVFPLELRLFNTSGDATNPDRMY
DLVAVVVHCGSGPNRGHYIAIVKSHEFWLLFDDDIVEKIDAQAIEEFYGLTSDISKNSES
GYILFYQSRD
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaagatgcccatgaattcttaaattaccttctaaatacaattgccgatatttta
caagaagagagaaagcaagaaaaacaaaatggccgtttacctaacggtaatattgacagt
gagaacaacaacagcacaccagacccaacgtgggttcatgagatttttcagggaacattg
acaaatgaaacccgatgtcttacttgtgaaactataagcagcaaagatgaagatttttta
gacctttctgttgacgtggaacaaaacacatcgatcactcactgcttaaggggttttagc
aacacagaaactctgtgcagtgaatacaaatattactgtgaagaatgtcgcagcaaacag
gaagcacacaaacggatgaaagttaaaaaactgcccatgattctagctctgcacctgaag
aggtttaaatacatggatcaacttcatcgatacacaaaactgtcttaccgggtagttttt
cctttagaacttcgtctgtttaacacctctggcgatgcaaccaatcctgacagaatgtac
gaccttgttgctgtggtggttcactgtggaagtggtcccaatcgaggtcattatattgca
atagttaagagtcatgagttttggttgttgtttgatgacgacattgtagaaaaaatagat
gcacaagctattgaagaattctacgggttgacatcagatatctcaaagaactctgagtct
ggttacatccttttctatcagtctcgggactga

DBGET integrated database retrieval system