KEGG   Canis familiaris (dog): 486117Help
Entry
486117            CDS       T01007                                 

Gene name
ENTPD4
Definition
ectonucleoside triphosphate diphosphohydrolase 4
Orthology
K12305  
ectonucleoside triphosphate diphosphohydrolase 4 [EC:3.6.1.6]
Organism
cfa  Canis familiaris (dog)
Pathway
Purine metabolism
Pyrimidine metabolism
Lysosome
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:cfa00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:cfa00240]
Cellular Processes; Transport and catabolism; Lysosome [PATH:cfa04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
25
AA seq 616 aa AA seqDB search
MGRIGISCLFPASWHFSISPVGCPRILNTNLRQIIVISILAAAVSLLYFSVVIIRNKYGR
LSRDKKFQRYLARVTDIEATDTNNPNVNYGIVVDCGSSGSPIFVYCWPRHNGNPHDLLDI
RQMRDKNRKPVVMKIKPGISEFATSPEKVSDYISPLLSFAAEHIPRAKHKETPLYILCTA
GMRILPESQQKAILEDLLTDIPVHFDFLFSDSHAEVISGKQEGVYAWIGINFVLGRFEHI
EDDEEAVVEVNIPGSESREAILRKRTAGILDMGGVSTQIAYEVPKTVSFASSQQEEVAKN
LLAEFNLGCDVHQTEHVYRVYVATFLGFGGNAARQRYEDRIFASTVQKNRLLGKQTGLAP
DTPFLDPCLPLDIKDEIQQNGQTMYLRGTGDFDLCRETIQPFMNKTNETQTSLNGVYQPP
IHFQNSEFYGFSEFYYCTEDVLRMGGDYNAATFTKAAKDYCATKWSILRERFDRGLYASH
ADLHRLKYQCFKSAWMFEVFHRGFSFPVNYKNLKTALQVYDKEVQWTLGAILYRTRFLPL
RDIQQETFRASHAHWRGFSFVYNHYLFSGCFLVVVLSILLYLLRLRRIHRRTLRSASTAT
LWLEEGLPSQKIAGTL
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atggggaggattggcatctcctgtctatttcctgcttcctggcattttagcatctctcca
gtggggtgtccgcgaattctgaataccaatttacgccagattattgttattagcattctg
gctgctgctgtttcgcttttatacttttctgttgttataatccgaaataagtatgggcgg
ctatccagagacaagaagtttcaaaggtacttggcacgagttactgacattgaagcgaca
gacaccaataaccccaatgtgaactacggtatcgtggtggactgtggtagcagtgggtct
ccaatattcgtctattgctggccaaggcacaacggcaatcctcatgatctgttggatatc
agacaaatgagggataaaaaccgaaaaccagtggttatgaaaataaaacccggcatttca
gaatttgctacctctccggagaaagtcagtgattacatttctccacttttgagctttgct
gcagagcacataccacgggcaaagcacaaagaaacgcctctctacattctctgcacagct
ggaatgagaatccttcctgaaagccagcagaaagccatcctggaagaccttctgactgat
atccccgtgcactttgactttctattttctgactctcatgcagaagtaatttcagggaaa
caagaaggtgtgtatgcttggattggcattaattttgtccttggacgattcgagcatatt
gaagatgatgaggaggcagttgtggaggttaacattcctggtagcgaaagcagggaagct
atcctccgtaaaaggacagccggtattctggacatgggaggcgtgtcaactcagatagcg
tacgaagttcccaaaactgtaagctttgcctcctcacagcaggaagaagtagctaagaac
ttgttagctgaatttaacttgggatgtgatgttcaccaaactgagcatgtataccgagtc
tatgtggccacatttcttgggtttggtggcaatgctgctcgacagagatatgaagaccga
atatttgccagcacagttcaaaagaacaggctcctgggtaaacagactggtctggctcct
gatactccattcttggacccctgcttacccctagacatcaaagatgaaatccaacaaaac
ggacagaccatgtacctccggggaacaggagattttgacctgtgtcgagagaccatccag
cctttcatgaataaaacaaatgagacacagacctctctcaacggggtctaccagcccccg
attcacttccagaacagtgaattctatggcttttcagagttctactattgcactgaggat
gtgttacgaatgggtggagactacaatgctgctacttttactaaagctgcaaaggattat
tgtgcaacaaagtggtcgatcttgcgggaacgttttgaccgcggactctacgcctcacat
gctgatctccataggctaaagtaccagtgcttcaaatctgcttggatgttcgaggtgttt
cataggggcttttcatttcctgtcaactataaaaatttaaagacggccttacaagtttat
gacaaggaggttcagtggacgctcggagcaatcctttacaggacccgttttttaccctta
agagatatccagcaggagaccttccgggccagtcacgcccactggcggggcttctccttt
gtctacaatcactacctgttctcaggctgcttcctggtagtcgtgctctccatcctcctc
tacctgctgcggctccggcgcattcacaggcggacgctccgcagtgcttcgactgccacc
ctctggctggaggaaggcctcccgtcccagaagattgctggtaccttatga

DBGET integrated database retrieval system