KEGG   Canis familiaris (dog): 486117Help
Entry
486117            CDS       T01007                                 

Gene name
ENTPD4
Definition
ectonucleoside triphosphate diphosphohydrolase 4
Orthology
K12305  
ectonucleoside triphosphate diphosphohydrolase 4 [EC:3.6.1.6]
Organism
cfa  Canis familiaris (dog)
Pathway
Purine metabolism
Pyrimidine metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    486117 (ENTPD4)
   00240 Pyrimidine metabolism
    486117 (ENTPD4)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    486117 (ENTPD4)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.6  nucleoside diphosphate phosphatase
     486117 (ENTPD4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
25
AA seq 616 aa AA seqDB search
MGRIGISCLFPASWHFSISPVGCPRILNTNLRQIIVISILAAAVSLLYFSVVIIRNKYGR
LSRDKKFQRYLARVTDIEATDTNNPNVNYGIVVDCGSSGSPIFVYCWPRHNGNPHDLLDI
RQMRDKNRKPVVMKIKPGISEFATSPEKVSDYISPLLSFAAEHIPRAKHKETPLYILCTA
GMRILPESQQKAILEDLLTDIPVHFDFLFSDSHAEVISGKQEGVYAWIGINFVLGRFEHI
EDDEEAVVEVNIPGSESREAILRKRTAGILDMGGVSTQIAYEVPKTVSFASSQQEEVAKN
LLAEFNLGCDVHQTEHVYRVYVATFLGFGGNAARQRYEDRIFASTVQKNRLLGKQTGLAP
DTPFLDPCLPLDIKDEIQQNGQTMYLRGTGDFDLCRETIQPFMNKTNETQTSLNGVYQPP
IHFQNSEFYGFSEFYYCTEDVLRMGGDYNAATFTKAAKDYCATKWSILRERFDRGLYASH
ADLHRLKYQCFKSAWMFEVFHRGFSFPVNYKNLKTALQVYDKEVQWTLGAILYRTRFLPL
RDIQQETFRASHAHWRGFSFVYNHYLFSGCFLVVVLSILLYLLRLRRIHRRTLRSASTAT
LWLEEGLPSQKIAGTL
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atggggaggattggcatctcctgtctatttcctgcttcctggcattttagcatctctcca
gtggggtgtccgcgaattctgaataccaatttacgccagattattgttattagcattctg
gctgctgctgtttcgcttttatacttttctgttgttataatccgaaataagtatgggcgg
ctatccagagacaagaagtttcaaaggtacttggcacgagttactgacattgaagcgaca
gacaccaataaccccaatgtgaactacggtatcgtggtggactgtggtagcagtgggtct
ccaatattcgtctattgctggccaaggcacaacggcaatcctcatgatctgttggatatc
agacaaatgagggataaaaaccgaaaaccagtggttatgaaaataaaacccggcatttca
gaatttgctacctctccggagaaagtcagtgattacatttctccacttttgagctttgct
gcagagcacataccacgggcaaagcacaaagaaacgcctctctacattctctgcacagct
ggaatgagaatccttcctgaaagccagcagaaagccatcctggaagaccttctgactgat
atccccgtgcactttgactttctattttctgactctcatgcagaagtaatttcagggaaa
caagaaggtgtgtatgcttggattggcattaattttgtccttggacgattcgagcatatt
gaagatgatgaggaggcagttgtggaggttaacattcctggtagcgaaagcagggaagct
atcctccgtaaaaggacagccggtattctggacatgggaggcgtgtcaactcagatagcg
tacgaagttcccaaaactgtaagctttgcctcctcacagcaggaagaagtagctaagaac
ttgttagctgaatttaacttgggatgtgatgttcaccaaactgagcatgtataccgagtc
tatgtggccacatttcttgggtttggtggcaatgctgctcgacagagatatgaagaccga
atatttgccagcacagttcaaaagaacaggctcctgggtaaacagactggtctggctcct
gatactccattcttggacccctgcttacccctagacatcaaagatgaaatccaacaaaac
ggacagaccatgtacctccggggaacaggagattttgacctgtgtcgagagaccatccag
cctttcatgaataaaacaaatgagacacagacctctctcaacggggtctaccagcccccg
attcacttccagaacagtgaattctatggcttttcagagttctactattgcactgaggat
gtgttacgaatgggtggagactacaatgctgctacttttactaaagctgcaaaggattat
tgtgcaacaaagtggtcgatcttgcgggaacgttttgaccgcggactctacgcctcacat
gctgatctccataggctaaagtaccagtgcttcaaatctgcttggatgttcgaggtgttt
cataggggcttttcatttcctgtcaactataaaaatttaaagacggccttacaagtttat
gacaaggaggttcagtggacgctcggagcaatcctttacaggacccgttttttaccctta
agagatatccagcaggagaccttccgggccagtcacgcccactggcggggcttctccttt
gtctacaatcactacctgttctcaggctgcttcctggtagtcgtgctctccatcctcctc
tacctgctgcggctccggcgcattcacaggcggacgctccgcagtgcttcgactgccacc
ctctggctggaggaaggcctcccgtcccagaagattgctggtaccttatga

  All links  
No link information was found.   
DBGET integrated database retrieval system