KEGG   Canis familiaris (dog): 486121Help
Entry
486121            CDS       T01007                                 

Gene name
EGR3
Definition
early growth response 3
Orthology
K12497  
early growth response protein 3
Organism
cfa  Canis familiaris (dog)
Pathway
Hepatitis B
Viral carcinogenesis
Class
Human Diseases; Cancers; Viral carcinogenesis [PATH:cfa05203]
Human Diseases; Infectious diseases; Hepatitis B [PATH:cfa05161]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
25
AA seq 349 aa AA seqDB search
MEPCAAWSPRGGRENVMDIGLTNEKPNPELSYSGSFQPAPGNKTVTYLGKFAFDSPSNWC
QDNIISLMSAGILGVPPASGALSTQTSTASMVQPPQGDVEAMYPALPPYSNCSDLYSEPV
SFHDPQGNPGLAYSPQDYQSAKPALDSNLFPMIPDYNLYHHPNDMGSIPEHKPFQGMDPI
RVNPPPITPLETIKAFKDKQIHPGFGSLPQPPLTLKPIRPRKYPNRPSKTPLHERPHACP
AEGCDRRFSRSDELTRHLRIHTGHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACEFC
GRKFARSDERKRHAKIHLKQKEKKAEKGGAPSASSAPPVSLAPVVTTCA
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggagccatgtgcggcgtggagtccccgcggtgggagagagaatgtgatggacatcggt
ctgaccaacgagaagcccaacccggaactctcttattcgggctccttccagccagccccc
ggcaacaagaccgtgacctacttgggaaagttcgccttcgactccccttccaactggtgt
caggacaacatcattagcctcatgagcgccggcatcttgggggtgcccccggcctcaggg
gcactcagcacgcagacctccaccgccagcatggtgcagccgccgcagggcgacgtggag
gccatgtacccggcgctgcccccctattctaactgcagtgatctctactcggagcctgtg
tctttccacgacccccagggcaaccccgggctcgcctattccccccaggattaccaatcg
gccaagccggccttggacagcaatctcttccccatgattcctgactacaacctatatcac
caccccaacgacatgggctccattccggagcacaagcccttccagggcatggaccccatc
cgggtcaacccgccccctattacccctctggagaccatcaaggcgttcaaagacaagcag
atccacccgggctttggcagcctgccccagccgccgctcacgctcaagcccatccggccc
cgcaagtatcccaaccggcccagcaagaccccgctccacgagcggccccacgcgtgcccg
gcggagggctgcgaccgccgtttcagtcgctcggacgagctgacccggcacctgcgcatc
cacacgggccacaagcccttccagtgccggatctgcatgcggagcttcagtcgcagcgac
caccttaccactcacatccgcacgcatacgggcgagaagccctttgcctgcgagttctgc
gggcgcaagtttgcgcgcagcgacgagcgcaagcgccacgccaagatccacctcaagcaa
aaggagaagaaggcggagaaggggggtgcgccctctgcgtcctcggcgccccccgtatcc
ctggcccctgtggtcaccacctgcgcctga

DBGET integrated database retrieval system