KEGG   Canis familiaris (dog): 486121Help
Entry
486121            CDS       T01007                                 

Gene name
EGR3
Definition
(RefSeq) early growth response 3
  KO
K12497  early growth response protein 3
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04625  C-type lectin receptor signaling pathway
cfa05161  Hepatitis B
cfa05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Organismal Systems
  Immune system
   04625 C-type lectin receptor signaling pathway
    486121 (EGR3)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    486121 (EGR3)
  Infectious diseases
   05161 Hepatitis B
    486121 (EGR3)
Transcription factors [BR:cfa03000]
 Eukaryotic Type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Egr/Krox
    486121 (EGR3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 DUF3446 zf-C2HC_2 zf-met zf-BED zf-C2H2_6 Zf_RING zf-H2C2_5
Motif
Other DBs
NCBI-GeneID: 486121
NCBI-ProteinID: XP_003433386
Ensembl: ENSCAFG00000009272
Position
25
AA seq 349 aa AA seqDB search
MEPCAAWSPRGGRENVMDIGLTNEKPNPELSYSGSFQPAPGNKTVTYLGKFAFDSPSNWC
QDNIISLMSAGILGVPPASGALSTQTSTASMVQPPQGDVEAMYPALPPYSNCSDLYSEPV
SFHDPQGNPGLAYSPQDYQSAKPALDSNLFPMIPDYNLYHHPNDMGSIPEHKPFQGMDPI
RVNPPPITPLETIKAFKDKQIHPGFGSLPQPPLTLKPIRPRKYPNRPSKTPLHERPHACP
AEGCDRRFSRSDELTRHLRIHTGHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACEFC
GRKFARSDERKRHAKIHLKQKEKKAEKGGAPSASSAPPVSLAPVVTTCA
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggagccatgtgcggcgtggagtccccgcggtgggagagagaatgtgatggacatcggt
ctgaccaacgagaagcccaacccggaactctcttattcgggctccttccagccagccccc
ggcaacaagaccgtgacctacttgggaaagttcgccttcgactccccttccaactggtgt
caggacaacatcattagcctcatgagcgccggcatcttgggggtgcccccggcctcaggg
gcactcagcacgcagacctccaccgccagcatggtgcagccgccgcagggcgacgtggag
gccatgtacccggcgctgcccccctattctaactgcagtgatctctactcggagcctgtg
tctttccacgacccccagggcaaccccgggctcgcctattccccccaggattaccaatcg
gccaagccggccttggacagcaatctcttccccatgattcctgactacaacctatatcac
caccccaacgacatgggctccattccggagcacaagcccttccagggcatggaccccatc
cgggtcaacccgccccctattacccctctggagaccatcaaggcgttcaaagacaagcag
atccacccgggctttggcagcctgccccagccgccgctcacgctcaagcccatccggccc
cgcaagtatcccaaccggcccagcaagaccccgctccacgagcggccccacgcgtgcccg
gcggagggctgcgaccgccgtttcagtcgctcggacgagctgacccggcacctgcgcatc
cacacgggccacaagcccttccagtgccggatctgcatgcggagcttcagtcgcagcgac
caccttaccactcacatccgcacgcatacgggcgagaagccctttgcctgcgagttctgc
gggcgcaagtttgcgcgcagcgacgagcgcaagcgccacgccaagatccacctcaagcaa
aaggagaagaaggcggagaaggggggtgcgccctctgcgtcctcggcgccccccgtatcc
ctggcccctgtggtcaccacctgcgcctga

DBGET integrated database retrieval system