KEGG   Canis familiaris (dog): 486168Help
Entry
486168            CDS       T01007                                 

Gene name
USP40
Definition
ubiquitin specific peptidase 40
Orthology
K11869  
ubiquitin carboxyl-terminal hydrolase 40 [EC:3.4.19.12]
Organism
cfa  Canis familiaris (dog)
Brite
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     486168 (USP40)
Peptidases [BR:cfa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   486168 (USP40)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
25
AA seq 755 aa AA seqDB search
MLFYRKSQLQRPPEARANPRYGVPCHLLNEMDAANIELQTKRAECDSIDNNFDLHLHLGP
HYHFLNGALHPVVSQAESTWDLTFDKRKTLGDLRQSIFQLLEFWEGDMVLSVAKLVPAGL
HVYQMLDGDDLTLCELEIADGEDLFVWNGVEVGGIQIPTGSDCEPLLLNVLHLATSSEGG
KCQQLVESPHVFPSNAEVGAVLTALAVPVGVLFINTTDPAGEENWVAIPKEDLKKTFREQ
GLRDRSSVLVQDSSDDNSLLLKQGKWFTGMNEVNWLQVQNLCELGSEEKQVKISATVNTV
VFDIRIKAIKELKLMKELAENSCLRPIDRNGKLLCPVPDSYTLKEAELKMGSSLGLCPGK
APTSSQLFLFFTVGSDVQPGTEMEIIVEETMSVRDCLQLMLGKSGLPGDRWHLRKMDWCY
EAGEPLCEEDATLRELMICSGDTLLLIEGKLPPPGFLKVPLWWYQPGGSPGHWKNHQDQR
NGAPSPGGVWRAAATQGAPGDLHGEVSLRYLGDLEISEEATVAELKSQAMTLFSSSGFVI
PSPAFLRAWTVERKRLGRLLRINRQQLRDYKLGRKTEICLEPLQEEENLGPQDVVLRTRM
RLPGERAYAPCVDLVWDTARGWTAGSLRQRVAHFCSLPVEKIEIAKYFPEKFEWLPISSW
NQQFTKRKKKKKQDNLQGAPYYLKDGDTIGIKNVLLEDDGDFSTDADDLGRGTPRRPSSQ
DALRERSRDLGCGATTPGRPRAPEASLSIHVRSFR
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
atgttgttttatcggaaatctcagttgcagagaccccctgaagctcgagctaatccaaga
tacggggttccgtgtcatttgctgaatgaaatggacgcagccaacattgaactgcaaaca
aaaagggcagaatgtgattctatagacaataattttgacttgcatctccacctgggccct
cattatcatttcctcaatggggctctgcacccagtcgtctctcaagcagaaagcacatgg
gatttaacctttgataaaagaaaaactttaggagatcttcgacaatcaatatttcagctg
ttagaattttgggaaggagatatggttcttagtgtggcaaaacttgtaccagcaggactt
cacgtttaccagatgcttgatggagatgacctgacgctgtgtgaactggagattgcagac
ggcgaagacctctttgtgtggaatggggtggaggttggtggcatccagattccaactggt
agtgactgtgaacctctgctcttaaatgttcttcatctagcaacaagcagcgagggggga
aagtgtcagcagttggtagagtcaccacatgtctttccgtccaatgcggaagtgggcgct
gtgctcacagctctggcggtccccgtgggtgtcctcttcatcaacaccactgaccctgcc
ggggaagagaactgggttgccattcccaaggaggacctgaagaagacgttcagagagcag
ggcctcagagaccggagctcggttctcgtgcaggattccagtgatgataacagtctgttg
ctcaaacaagggaaatggttcactggtatgaatgaggtcaactggctccaagttcaaaac
ttatgcgaattaggatccgaagagaagcaagttaaaatatcagcaactgtgaacacagtg
gtgtttgatattcgaattaaagccataaaggaattaaaattaatgaaggaactagctgag
aacagctgtttgaggcctattgatagaaacgggaagctgctttgtccagtgccagacagt
tacaccttgaaggaagcagaactgaagatggggagttcactggggctatgtcctgggaaa
gcaccaacttcctcccagctgttcctgtttttcactgtggggagtgatgttcagcccggt
acagagatggagatcatagtagaagaaacgatgtctgtgagagattgtttacagctcatg
ctggggaagtctggcctaccgggagacaggtggcatttacgaaaaatggattggtgttat
gaagctggagagcctttatgtgaagaggatgcaaccctgagagaacttatgatatgttct
ggagatactttacttttaattgaaggaaaacttcctcctccgggtttcctgaaggtgccc
ctctggtggtaccagcctgggggttccccgggtcactggaagaatcatcaggaccagagg
aacggtgccccttctccaggtggggtctggagagctgctgccacccaaggcgctcctggt
gacctgcacggggaggtgtccctccgctacttgggggacctggagatctcagaagaggcc
accgtggcagagctgaagtcccaggccatgaccttgttctcctcctcggggtttgtcatc
ccgtccccagccttcctcagagcctggaccgtggagaggaagcgcctgggcaggctttta
cgaatcaaccgccagcagctcagagactacaaactgggacggaaaactgagatctgctta
gagccccttcaggaagaagaaaacttgggccctcaggacgtggtactgaggacacggatg
cgcctcccgggcgagagggcgtacgcgccgtgcgtggacttggtgtgggacaccgcccga
ggctggactgctggctccctgagacaacgagttgcccacttctgctctcttcccgtggag
aaaattgaaattgccaagtacttccccgaaaagtttgagtggcttccgatatctagctgg
aaccagcaatttaccaagaggaaaaagaagaaaaagcaagataatttgcagggggcgcct
tattacttgaaagatggagacactattggtattaagaatgtcctgctggaggacgacggg
gacttcagtaccgacgcggacgacctggggagagggacgccgaggcggccgagcagccag
gacgcccttcgtgagcgcagccgcgacctcggctgcggggccacgacgcccggccggccc
cgcgcaccagaagcttctctttccatccatgtgcggagcttcaggtag

DBGET integrated database retrieval system