KEGG   Canis familiaris (dog): 486317Help
Entry
486317            CDS       T01007                                 

Gene name
DAO
Definition
D-amino-acid oxidase
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
cfa  Canis familiaris (dog)
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Peroxisome
Class
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:cfa00260]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:cfa00330]
Metabolism; Metabolism of other amino acids; D-Arginine and D-ornithine metabolism [PATH:cfa00472]
Metabolism; Biosynthesis of other secondary metabolites; Penicillin and cephalosporin biosynthesis
Cellular Processes; Transport and catabolism; Peroxisome [PATH:cfa04146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
26
AA seq 347 aa AA seqDB search
MRVVVIGAGVIGLSTALCIHERYQSVLPSLDVRVYADRFTPLTTTDVAAGLCQAYLSDPS
NPQEAHWNQQTFDYLLSHIHSPNAASMGLALISGYNLFHETIPDPSWKDAVLGFRRLTRR
ELDMFPNYSYGWFNTSLIVEGRRYLEWLTKRLTERGVKFFQQKVESFEEMARGGADVIIN
CTGVWAGALQPDPLLKPGRGQIIKVDAPWMKHFIITHDLAKGIYQTPYIIPGIQTVTLGG
IFQLGNWSEANNIQDHNTIWESCCSLEPTLKDAKIVAEFTGLRPVRPQIRLEREQLRFGS
SNTEVIHNYGHGGYGLTIHWGCAMEAAKLFGKVLEERKLLRMPPPHL
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtggtagtgatcggagcgggcgtcattgggctgtccaccgccctctgcatccac
gagcgctaccagtcagtcctgccatcgctggatgtgagggtctacgcagaccgcttcacc
ccgctcaccaccactgacgtggctgctggcctctgtcaagcctacctctcggaccccagc
aacccacaggaggcgcattggaaccagcagaccttcgactatcttctgagccacatccat
tctcccaacgctgcgagcatgggcctggccctaatctcaggctacaacctcttccatgaa
actattccggatccttcctggaaggacgcagttctgggatttcggaggctgacccgtaga
gagctggacatgttccccaattacagctatggctggttcaacacaagcctgattgtggag
gggaggaggtatctcgagtggctgactaaaaggttaactgagaggggagtgaaattcttc
cagcagaaggtggagtctttcgaggagatggcaagaggaggtgccgacgtgattatcaac
tgcaccggggtgtgggctggggcattgcaaccagatcccttgctgaagccaggtcgggga
cagatcattaaggtggatgccccttggatgaagcacttcattatcacccatgacctagcg
aaaggcatctaccagaccccatacatcatcccagggatccagacagtgactctgggaggc
atctttcagctggggaactggagtgaggcaaacaacatccaggaccacaacactatctgg
gaaagctgctgtagcctggagcccacactgaaggatgcaaaaattgttgctgaatttact
ggtctccggccagttcgcccccagattcggctagaaagggaacagcttcgctttggatct
tcaaacacagaggtcatccacaactatggccatggaggctacgggctcaccatccactgg
ggctgtgctatggaggcagccaagctatttgggaaagtcctagaagaaaggaagttgctc
aggatgccgccaccccacctctga

DBGET integrated database retrieval system