KEGG   Canis familiaris (dog): 486497Help
Entry
486497            CDS       T01007                                 

Gene name
SMUG1
Definition
single-strand-selective monofunctional uracil-DNA glycosylase 1
Orthology
K10800  
single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
cfa  Canis familiaris (dog)
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    486497 (SMUG1)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     486497 (SMUG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
27
AA seq 253 aa AA seqDB search
MEPQPCLRSLAEGFLAEELRLNNELSQLQFSEPVGIIYNPLEYAWEPHHSYVTRYCRGPK
EVLFLGMNPGPFGMAQTGVPFGEVNVVRDWLGIGGTVSTPAQEHPKRPVLGLECPQSEVS
GARFWGFFQNLCGQPEVFFRHCFVHNLCPLLFLDPNGRNLTPAELPAKQREQLLRVCDAA
LFRQVQLLEVRLVVGVGRLAEQRARRALAGLLPEVRVEWLLHPSPRSPQANRGWEAAAKD
RLSELGLLPLLTR
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggagccccagccttgccttcgaagcttggctgagggcttcctggcggaggagctgcgg
ctcaataatgaactgagccaactgcagttctcagagcctgtgggcatcatctacaatcct
ttggagtatgcgtgggagccacaccacagctacgtgacccgctactgccggggccccaag
gaagtgctcttcctgggcatgaaccccgggccctttggcatggctcagactggggtgccc
ttcggggaagtgaacgtagtccgggactggttgggcattggggggactgtgtcgaccccg
gcccaagagcacccgaagcgcccagtgctgggactggagtgccctcagtcagaggtgagc
ggtgcccggttctggggctttttccagaacctctgtggacagcccgaggtcttcttccgt
cactgttttgtccacaatctatgtcctctgctcttcttggaccccaacgggcgcaacctc
acccccgccgagctgccggccaagcagcgagagcagcttcttagggtctgtgacgcagcg
ctcttccggcaggtgcagctgctggaggtgcggctggtggtgggcgtggggcggctggcg
gagcagcgggcgcggagggcgctggccggcctgctgcccgaggtcagggtggagtggctc
ctgcacccctccccccggagcccgcaggccaacaggggctgggaggcagcggccaaggac
agactgagtgagctggggctgctgccgctgctcacgaggtga

DBGET integrated database retrieval system