KEGG   Canis familiaris (dog): 486558Help
Entry
486558            CDS       T01007                                 

Gene name
KMT2D, MLL2
Definition
lysine (K)-specific methyltransferase 2D
Orthology
K09187  
histone-lysine N-methyltransferase MLL2 [EC:2.1.1.43]
Organism
cfa  Canis familiaris (dog)
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:cfa00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
27
AA seq 5672 aa AA seqDB search
MDSQKPPGEDKDSEPAADGPAASEESGTTEPDLPNPYVGEVSVPSSGGPRLQEPPRDCSG
GPVRRCALCNCGEPSLHGQRELRRFELPFDWPQCPVVSPGGNPGPNEAVLPSEDLSQIGF
PEGLTPAHLGEPGGSCWAHHWCAAWSAGVWGQEGPELCGVDKAIFSGISQRCSHCTRLGA
SIPCRSPGCPRLYHFPCATASGSFLSMKTLQLLCPEHSEGAAHLEEARCAVCEGPGELCD
LFFCTSCGHHYHGACLDTALTARKRAGWQCPECKVCQACRKPGNDSKMLVCETCDKGYHT
FCLKPPMEELPAHSWKCKACRVCRACGAGSAELNPNSEWFENYSLCHRCHKAQGGQLIGS
VAEQHPPVCSRFSPLEPGDTPTDEPKALYVACQGQPKGGHVTSMQPKEPGPLQCEAKPLG
RAGAQLEPRLEVPLNEEMPLLPPPEESPLSPPPEESPTSPPPEASRLSPPPEESPLSPPP
EESPLSPPPESSPFSPLEESPFSPPEESPPSPPLETPLSPPPEASPLSPPFEESPLSPPP
EELPTSPPPEASRLSPPPEESPMSPPPEESPMSPPPEASRLFPPFEESPLSPPPEESPLS
PPPEASRLSPPPEDSPMSPPPEDSPVSPPPEVSCLSSLPEVSRLSPPPEESPLSPPPEES
PTSPPPEASRLFPPPEDSPTSPPPEDSPASPPPEDLLMTLPLEESSLLPLPEEPRLCPLP
EEPRLPPQPEEPRLSPRPEEPRLSPQPEEPRLSPRPEEPRLSPQPEEPRLSPALEEPCLS
PAPEELRLPLWLEEPRLSPRPEKPCLSPAPEELHLSPRPEEPRLSPRPEEPRLSPRPEEP
RLSPQPEEPRLSPRSEEPCLSPAPEEPRLSPMPEEPQLSPRPEEPPLSPMPEEPPLSPGP
EEPRLSPGPEEPRLSPRPEEPRPSPQPEEPRLSLGPEEPRLSPRPEEPCLSPRPEEPRLS
PRPEEPPEEPGLCPAPEELPLFLPPGEPSLSPLLGEPALSEPGEPPLSPLPEELPLSPSG
EPSLSPQLMPPDPLPPPLSPIITTVAPPALSPLGELEYPFGAKGDSDPESPLAAPILETP
ISPPPEANCTDPEPVPPMILPPSPGSPMGPASPILMEPLPSRCSPLLQPSLPPQNSPPSQ
CSLPALPLSVPSPLSPMEKAVEVSDEAEPHEMETEKVPEPECPALEPSPTSPLPSPMGNL
SCPAPSPAPALDDFSGLGEDTAPLDGTDTPGSQPEAGQTPGSLASELKGSPVLLDPEELA
PVTPMEVYGPEGKQAGQGSPCEEQEEPRVPVAPTPPTLIKSDIVNEISNLSQGDASASFP
GSEPLLGSPDPEGGGSLSMELGVSTDVSPARDEGSLRLCTDSLPETDDSLLCDAGTAIGG
GKAEGDKGRRRSSPARSRIKQGRSSSFPGRRRPRGGAHGGRGRGRARLKSTTSSIETLVV
ADIDSSPSKEEEDDDDDTMQNTVVLFSNTDKFVLMQDMCVVCGSFGRGAEGHLLACSQCS
QCYHPYCVNSKITKVMLLKGWRCVECIVCEVCGQASDPSRLLLCDDCDISYHTYCLDPPL
LTVPKGGWKCKWCVSCMQCGAASPGFHCEWQNSYTHCGPCASLVTCPICHTPYVEEDLLI
QCRHCERWMHAGCESLFTEDDVEQAADEGFDCVSCQPYVVKPAAPVAPPELVPMKVKEPE
PQYFRFEGVWLTETGMAVLRNLTMSPLHKRRQRRGRLGLPGEAGLEGSEPSDALGPDDKK
DGDLDTDELLKGEGGVEHMECEMKLEGPVSPDVEPGREETEESKKRKRKPYRPGIGGFMV
RQRKSHTRVKKGPAAQAEVLSGDGQPDEGETVMPVDLPVEGPVDQSLADGDEKKKQQRRG
RKKSKLEDMFPAYLQEAFFGKELLDLSRKALFAVGMGRPTFGLGTPKAKGDGGSDRKELP
TSQKGDDGPDVADEESRGPEGKADTPGPEDGGVKASPVPSDPEKPGTPGEGMLSSDLDRI
PTEELPKMESKDLQQLFKDVLGSEREQHLGCGTPGPDGSRTPLQRPFLQGGLPLGNLPSS
SPMDSYPGLCQSPFLDSRERGGFFSPEPGEPDSPWTGSGGTTPSTPTTPTTEGEGDGLSY
NQRSLQRWEKDEELGQLSTISPVLYANINFPNLKQDYPDWSSRCKQIMKLWRKVPAADKA
PYLQKAKDNRAAHRINKVQKQAESQINKQTKVGDMARKTDRPALHLRIPPQPGALGSPPP
AAAPTIFIGSPTTPAGLSTSADGFLKPPVGTVPGPDSPGELFLKLPPQVPAQVPSQDPFG
LAPAYALEPRFPTAPPTYPPYPSPTGAPAPPLTLGASSRPGTGQPGEFHTTPPGTPRHQP
STPDPFLKPRCPSLDNLAVPESPGIGGGKAAEPLLSPPPFGESRKALEVKKEELGASSPS
YGPPNLGFVDSPSSGPHLGSLELKAPDVFKAPLTPRASQVEPQSPGLGLRPQEPPPAQAL
APSSPSHSDIFRPGPYPDPYAQPPLTPRPQPPPPESCCALPPRSLPSDPFSRVPASPQSQ
SSSQSPLTPRPLSAEAFCPSPVTPRFQSPDPYSRPPSRPQSRDPFAPLHKPPRPQPPEVA
FKAGPLAHTPLGAGGFPAALPSGPTGELHAKVPSGQPPNFARSPGTGAFVGTPSPMRFTF
PQAVGEPSLKPPVPQPGLPPPHGINSHFGPGPTLGKPQSTNYAVATGNFHPSGSPLGSSS
GSTGEGFGLSPLRPPSVLPTPAPDGSLPYLSHGASQRAGITSPVDKREDPGAGMGGSLVA
PELPGTQDPSLSSLSQTELEKQRQRQRLRELLIRQQIQRNTLRQEKETAAAAAGAVGPPG
SWGAEPSSPAFEQLSRGQTPFAGTQDKSSLVGLPPSKLGGPILGPGAFPGDDRLSRPPPP
ATPSSLDVNSRQLVGGSQAFYQRAPYPGSLPLQQQQQQQQLWQQQQQQQQQATAATSMRL
AMSTRFPSTPGPELGRPALGSPLAGLPTRLPGPGEPVPGPAGPAQFIELRHNVQKGLGPG
GAPFPGQGPPQRPRFYPVSEDSHRMAPEGLRGLAVSGLPPQKPSAPPAPELNNSVHPIPH
TKGPSLPTSLELVSRPPSSTELGRPPPLALEAGKLPCEDPELDDEFDAHKALEDDEELAH
LGLGVDVAKGDDELGTLENLETNDPHLDDLLNGDEFDLLAYTDPELDTGDKKDIFNEHLR
LVESANEKAEREALLRGVEPVSLGPEERPPPAADASEPRLASVLPEVKPKVEEGGRHPSP
CQFAITTPKVEPAPATTSLSLGLKPGQSVMGSRDTRMGTGPFSSSGHTTEKGPFGATGGP
PAHLLTPSPLSGPGGSSLLEKFELESEALTLPGGHTASGDELDKMESSLVASELPLLIED
LLEHEKKELQKKQQLSAQLQPVQQQQQQQQQQQQHSLLSAPGPAQAMSLPHEGSSPSLSG
PQQQLALGLGGSRQPGLAQPLMPTQPPAHALQQRLAPSMAMVSNQGHMLSGQHGGQAGLV
PQQSSQPVLAQKPMGTMPPSMCMKPQQLAMQQQLANSFFPDTDLDKFAAEDIIDPIAKAK
MVALKGIKKVMAQGSIGVAPGMNRQQVSLLAQRLSGGPGSDLQNHVAAGSGQERSAGDPS
QPRPNPPTFAQGVINEADQRQYEEWLFHTQQLLQMQLKVLEEQIGVHRKSRKALCAKQRT
AKKAGREFPEADAEKLKLVTEQQSKIQKQLDQVRKQQKEHTNLMAEYRNKQQQQQQQQQQ
QQQQHSAVLALSPSQSPRLLTKLPGQLLPGHGLQPPQGPPGGQATGLRLPPGGMTLPGQP
GGPFLNTSLAQQQQQQHSGGAGALGGPSGGFFPGNLALRGLGPDSRLLQERQLQLQQQRM
QLAQKLQQQQQQHLLGQVAVQQQQQQSLGVQANQALGPKPQGLLPPSSRQGLLVQQLSPQ
PPQGPQGMLGPAQVAVLQQQQQQQHPGALGPQGPHRQVLLTQSRVLSSPQLAQQGQGLMG
HRLVTAQQQQQQQQQQQQQQHQQQGSMAGLSHLQQGLMPHGGQPKLSTQPMAALQQQQLQ
QQQQQQQQQLQQQQQQQQQLQQQQQQQLQQQQQQQLQQQQLQQQQQFQQQQQQLQQQQQQ
QFQQQQQQQQQQQQQQQQQMGLLNQSRTLLSPQQQQPQQPQQQVPLGPGMPAKPSQHFSS
PGALGTTVLLTGKEQSMVETALPPEATEGPSTHQGAPLALGTVPESAATEPGEVKPSLSG
DSQLLLVQPQTQPQPSSAQLQPPLRLPGPQQQQVNLLHTATVGSHGQAGSGSSSEASPMP
HLLAQSSVPLGEQPGTMTQNLLGSQQPLGLERPVQNNAGPQPAKAGSVPQSGPGLPGPGV
MPTVGQLRAQLQGVLAKNPQLRHLSPQQQQQLQALLMQRQLQQSQAVRQAPPYQEPGAQP
SPLQGLLGRQPQLGGFPGSQTGPLQELGVGLRPQGPPRLPAPQGALATGPVLGPVHPTPP
PSSPQEPKRPSSQPPGASPLVPSQLPSEAQLPPTQPGTPKPQGPSLELPPGRVSPAAAQL
ADTFFGKGLGPWDPPDSLVEAQKPEQSSLVPGHLEQVNGQAVPEPPHLSIKQEPREEPCA
LGAQAVKREANGEPIGAPGTSNHLLLAGPRSEAGHLLLQKLLRAKNVQLSTGRGPEGLRA
EINGHIDSKLAGLEQKLQGTPSNKEDTAARKPVTPKPKRVQKASDRLVSSRKKLRKEDGV
RASEALLKQLKQELSLLPLTEPTITANFSLFAPFGSGCPVNGQCQLRGAFGSGALPTGPD
YYSQLLTKNNLSNPPTPPSSLPPTPPPSVQQKMVNGVTPSEELGEHPKDAASARDTEGTL
RDASEVKSLDLLAALPTPPHNQTEDVRMESDEDSDSPDSIVPASSPESILGEEAPRFPQL
GSGRWEQEDRALSPVIPIIPRASIPVFPDTKPYGALDLETSGKLPATTWEKGKGSEVSVM
LTVSAAAAKNLNGVMVAVAELLSMKIPNSYEVLFPESPARAGIEPKKGEAEGPGGKEKGL
GGKSPEAGPDWLKQFDAVLPGYTLKSQLDILSLLKQESPAPEPPTQHSYTYNVSNLDVRQ
LSAPPPEEPSPPPSPLAPSPASPPAEPLVELPAEPSAEPPVPSPLPLASSPESARPKPRA
RPPEEGEDSRPPRLKKWKGVRWKRLRLLLTIQKGSGRQEDEREVAEFMEQLGTALRPDKV
PRDMRRCCFCHEEGDGATDGPARLLNLDLDLWVHLNCALWSTEVYETQGGALMNVEVALH
RGLLTKCSLCQRTGATSSCNRMRCPNVYHFACAIRAKCMFFKDKTMLCPMHKIKGPCEQE
LSSFAVFRRVYIERDEVKQIASIIQRGERLHMFRVGGLVFHAIGQLLPHQMADFHSATAL
YPVGYEATRIYWSLRTNNRRCCYRCSIGENNGRPEFVIKVMEQGLEDLVFTDASPQAVWN
RIIEPVAAMRKEADMLRLFPEYLKGEELFGLTVHAVLRIAESLPGVESCQNYLFRYGRHP
LMELPLMINPTGCARSEPKILTHYKRPHTLNSTSMSKAYQSTFTGETNTPYSKQFVHSKS
SQYRRLRTEWKNNVYLARSRIQGLGLYAAKDLEKHTMVIEYIGTIIRNEVANRREKIYEE
QNRGIYMFRINNEHVIDATLTGGPARYINHSCAPNCVAEVVTFDKEDKIIIISSRRIPKG
EELTYDYQFDFEDDQHKIPCHCGAWNCRKWMN
NT seq 17019 nt NT seq  +upstreamnt  +downstreamnt
atggacagccagaagccgcctggtgaggataaagattcagaaccggcagctgatggacct
gcagcctctgaggagtcaggcaccactgagccagaccttcccaacccatatgtgggggag
gtctctgtgcccagttctggaggtcctaggcttcaggagcctccccgggactgcagtggg
ggtccagtgcggcgttgtgctctctgtaactgcggggagcctagtctacatgggcagcgg
gaactacggcgctttgagttgccatttgactggccccagtgtccagtggtgtcccctggg
gggaacccagggcccaacgaggcagtgctgcccagtgaggacctgtcacagattggtttc
cctgagggcctgacacctgcccacctaggagaacctggagggtcctgctgggctcaccat
tggtgtgctgcgtggtcggcaggtgtatgggggcaggagggcccagaactatgtggtgtg
gacaaggccatcttctcagggatctcacagcgctgctcccactgcaccaggctcggtgcc
tccatcccttgccgctcacccggatgtccacggctttaccacttcccttgtgcgactgcc
agcggttccttcttatccatgaaaacactgcagctgctatgcccggagcacagtgagggg
gctgcacatctggaggaggctcgttgtgcagtatgcgaggggccaggggagttgtgtgac
ctgttcttctgtaccagttgtgggcatcactatcacggggcctgcctggacactgctctt
accgcccgcaagcgtgctggctggcagtgccctgaatgcaaagtgtgccaagcctgcagg
aaacctgggaatgactctaagatgttggtctgtgagacgtgtgacaaaggataccatacc
ttctgcctcaagccaccaatggaggaattgccagctcactcttggaagtgcaaggcatgc
cgggtatgccgggcctgtggggcaggctcagcggagctgaatcccaactctgagtggttt
gaaaactactcactctgtcaccgctgtcacaaggcccagggaggacagcttattggttct
gtggctgagcagcatccccctgtctgcagcaggttctcacccctagagcctggcgatacc
cccactgacgagcccaaagctctgtacgttgcatgccaagggcagccaaagggtgggcac
gtgacctccatgcaacccaaggaaccggggcccctgcaatgtgaagccaaaccactaggg
agagcaggggcccaacttgagccccggttggaggtccccctaaacgaggagatgccactg
ctgcccccacctgaggagtcgcccctctccccaccacctgaggaatcgcccacatcccca
ccacctgaggcatcgcgtctgtccccaccaccggaggaatcacccctctctccgccgcct
gaggagtctcctctgtctcctccacctgaatcatcacctttttctccactggaggagtcg
ccgttctctccaccagaggagtcacccccatctcccccacttgagacgcccctgtctcca
ccgcctgaagcatcacccctctccccaccatttgaagagtctcccttatcccccccacct
gaggagttgcccacttccccgccacctgaagcatctcgcctgtctccaccacctgaggag
tcacccatgtccccgccacctgaagagtcacccatgtctccgccacctgaagcatctcgt
ctgttcccaccatttgaagaatcgcccctgtcccctccaccagaggagtctcccctctcc
ccaccacctgaggcatcccgtctgtccccacctcctgaggactcgcctatgtccccacca
cctgaagactcgcctgtgtcccccccacctgaggtatcctgcctgtcctccctgcctgag
gtgtcacgcctgtccccaccacctgaggaatctcccctgtccccaccacccgaagagtcc
cccacatcccctccacctgaggcttcccgcctgttcccaccacctgaggactccccgact
tccccgccgcctgaagactcacctgcttctccgccaccggaggacttactcatgacccta
ccgctagaggagtcatccctgttgccactgcccgaggagccacgactctgccccctgccc
gaggagccgcgcctgccccctcagcccgaggagccgcgcctgtcccctcggcctgaggag
ccgcgcctgtcccctcagcccgaggagccacgcctgtcccctcggcccgaggagccgcgc
ctgtcccctcagcctgaggagccgcgcctgtcccccgcacttgaggaaccatgcctgtcc
cccgcgcctgaggagctgcgcctgcccctttggcttgaggagccacgtctgtccccccgg
cctgagaagccatgcctgtcccctgcccctgaggagctgcacctgtccccccggcctgag
gagccgcgcctgtccccccggcctgaggaaccgcgcctgtccccccggcctgaggaaccg
cgcctgtcccctcagcctgaggagccgcgcctgtccccccggtctgaggagccgtgcctg
tcccccgcgcctgaggagccacgcctgtcccccatgcctgaggagccgcagttgtctccc
cggcctgaggagccgcccctgtcccccatgcctgaggagccgcccctgtcccccgggcct
gaggagccgcgcctgtcccccgggcctgaggagccgcgcctgtccccccggcctgaggag
ccacgcccgtcccctcaacctgaggaaccgcgcctgtcccttggacctgaggaaccgcgc
ctgtcccctcgacctgaggaaccgtgcctgtcccctcgacctgaggaaccgcgcctgtcc
cctcgacctgaagagccccctgaggagccaggcctatgccctgcacctgaggaattgccc
ttgttcctcccacctggggagccatctttatcccccttgcttggagagccggccctgtct
gagcctggggaaccacctctgtcccctctaccagaggagttgccgttgtccccatccggg
gagccatccttgtcacctcagctgatgccaccagatcctcttcctcctccgctctcaccc
attatcacaactgtggccccgccggctctgtctcctttgggggagttagaataccccttt
ggtgccaaaggggacagtgaccctgagtcgccgttggctgcccccatccttgagacgccc
atcagccctccaccagaagctaactgcactgaccctgagcctgtgccccctatgatcctc
cccccatctccaggctccccaatgggaccagcctctcccatcctgatggagccccttccc
tctcggtgttctccactcctgcaaccttcccttcctccccaaaactctcctccttcccaa
tgttctcttcctgctctgccattgtccgttccctccccactgagtcccatggagaaggca
gtggaggtctcagatgaggctgagccgcatgagatggagactgagaaagtcccagaacct
gagtgtccagccttggaacccagccccactagtcctctcccctcgcccatggggaacctt
tcctgccccgcacccagccctgccccagctctggatgacttctctggtctgggggaagac
acagcccctctggatgggactgacactcctggttcacagccagaggctggacagacccct
ggcagtttggctagtgaacttaagggttcccctgtgctcctggaccccgaggagctggcc
cccgtgacccctatggaggtctatggcccagaaggcaagcaggcagggcagggttcaccc
tgtgaagagcaagaggagccacgtgtaccggtggcccctaccccacccactctcatcaaa
tccgacatcgttaatgagatctctaatctgagccagggtgatgccagtgccagttttcct
ggctcagagcccctgctaggctctcccgaccccgaggggggcggctccttgtccatggag
ctgggggtatctacagacgttagtccagcccgggatgagggctccctgcggctctgtact
gactcgctgccagagactgacgactcgctactatgtgatgctgggacagcaattggcgga
ggcaaagccgagggggacaaggggaggcggcgcagctccccggctcgttcccgcatcaaa
cagggtcgcagcagtagtttcccaggaagacgccggccacgtggaggagcccatggagga
cgtgggagaggacgggcccggctaaaatcaactacttcttccattgagactctggtagtt
gctgatatcgatagctctcccagcaaagaggaagaagacgacgatgacgacaccatgcaa
aatactgtggttctcttctccaacacagacaagtttgtcctaatgcaggacatgtgcgtg
gtttgtggcagctttggccggggggcagagggccacctccttgcctgttcccagtgttcc
cagtgctatcacccttactgtgtcaacagcaagatcaccaaggtgatgctgctaaagggc
tggcgttgcgtggagtgcatcgtgtgtgaggtgtgtggccaagcctcggacccctcacgc
ctgctgctctgtgatgactgtgacattagctaccacacatactgcctggacccgccactg
ctcaccgtgcccaaggggggctggaagtgcaagtggtgtgtgtcttgtatgcagtgtggg
gccgcctcccctggcttccactgtgaatggcaaaatagttacacacactgcggcccctgc
gccagcctggtgacctgccctatctgtcacaccccatacgtggaagaggacctactaatc
cagtgccgccactgtgaacggtggatgcatgctggctgcgagagcctcttcacggaggat
gacgtggagcaggcggccgatgagggctttgactgtgtctcctgccagccctatgtagta
aagcctgctgcacctgtcgcacctccagagttggtgcctatgaaggtgaaagagccagag
cctcaatactttcgcttcgagggcgtgtggctgacagaaacgggcatggctgtgctgcgt
aaccttaccatgtcacccctgcacaagcggcgccagcggcgaggacggcttggcctccca
ggcgaggcagggctggagggttctgagccctcagatgcccttggtcctgatgacaagaag
gatggggacctggacactgatgagctgctcaagggtgaaggtggcgtggagcacatggaa
tgtgaaatgaaactggagggccctgtcagccctgacgtggagcctggcagagaggaaact
gaggaaagcaagaaacgcaaacgcaaaccctatcggcctggcatcggtggtttcatggtg
cgacagcggaaatcccacacacgtgtgaaaaaggggcctgctgcacaggcggaggtgttg
agtggggatgggcagcccgacgagggtgagacggtgatgcctgtggacctgcctgttgag
ggccctgtggaccagagcttagctgatggggatgagaaaaagaagcagcagaggcgaggg
cgcaagaagagcaaactggaagacatgtttcctgcttatttgcaggaagccttctttggg
aaggagctgttggacctgagccggaaggccctttttgcagttgggatgggccggccaact
tttggcctaggaaccccaaaagccaaaggggatggaggctcagataggaaggagctcccc
acctcacagaaaggagatgatggtccggatgttgcagatgaagaatcccgtggccctgag
ggcaaggctgatacaccaggacctgaggatggaggtgtgaaggcatccccagtgcccagt
gaccccgagaagcctggcactccgggtgaagggatgcttagctctgacttagataggatt
cccacggaagaactgcccaagatggaatccaaggacctgcagcagctcttcaaggatgtt
ctgggttctgaacgagagcagcacctgggttgcggaacccccggcccagatggcagccgt
acaccgctgcagaggccctttctccaaggtggactccctttgggcaatctcccctccagc
agcccaatggactcctacccaggcctctgccagtccccatttctggattctagggagcgc
gggggcttctttagcccggaacccggtgagccagacagcccctggacaggctcggggggc
accacgccctccacccccaccacccccaccacggagggtgagggcgacgggctctcctat
aaccagcggagccttcagcgctgggagaaggatgaggagttgggccagctctccaccatc
tcgcctgtgctctatgccaacattaactttcccaatctcaagcaggattacccagactgg
tctagccgttgcaaacaaatcatgaagctctggagaaaagttccagctgctgacaaagcc
ccctacctgcaaaaggccaaagataaccgggcggctcaccgcatcaacaaggtgcaaaag
caggctgagagccagatcaacaagcagaccaaggtgggcgacatggcccgtaagactgac
cgaccagccctacatctccgcattcccccccagccaggggcactgggcagtccgccccct
gctgctgcccccaccattttcattggcagccccacaacccccgccggcttgtctacctct
gcggacgggttcctgaagccgccagtgggcacagtgcccggccccgactcgcccggtgag
ctcttcctcaagctcccaccccaggtgcccgcccaagtgccttcgcaggacccctttgga
ctggcccccgcctacgctctggagcctcgcttccccacggcaccacctacctatcctccc
tatcctagtccgactggggcccccgcgccgcctctgacgctgggcgcctcatctcgtcct
gggactggccagccaggggaattccacactaccccacctggcaccccccgacaccagccc
tccacacctgacccctttctcaaaccccgctgcccctcactggacaacctggctgtgcct
gagagcccagggatagggggaggcaaggctgccgaacccctgctgtcacccccacctttt
ggcgagtctcggaaggccctagaggtgaagaaggaagagcttggggcatcctctccgagc
tacgggcccccaaacctaggctttgttgactcaccttcctcaggcccccacctgggcagc
ctggagttaaaggcacccgatgtcttcaaagcccccctgacccctcgggcatctcaggta
gagccccagagcccgggcttgggcctaaggccccaagagccacctcctgcccaggctttg
gccccttcttcccccagccactcggacatctttcgccctggcccttaccctgatccctat
gcccagccgccattgacccctcggccccaacccccacctcctgagagctgctgtgccctg
cctcctcgctcattgccctcagaccctttctcccgagtgcccgcgagtccccagtcccag
tccagctcccagtctccgttaacaccccgtcctttgtctgccgaggctttttgcccatcc
cctgttacccctcgcttccagtcccctgacccctattcccgtcctccctcacgccctcag
tcccgtgacccatttgcccccttgcataagccaccccgaccccagccccctgaagttgcc
ttcaaggctgggcctctagcccacactccactgggggctggcggcttcccagcagccctg
ccctcagggccaacaggtgagctccatgctaaggtcccaagtggacagcccccaaatttc
gcccggtcccctgggacgggtgcttttgtgggcaccccctctcccatgcgtttcactttc
cctcaggcggtaggggagccttccctaaagccccctgtccctcagcctggtctccctcca
ccccatgggatcaacagccattttgggcctggccctaccttgggcaagcctcaaagcaca
aactacgcagtagccacagggaatttccacccatcgggcagccccctgggatccagcagc
gggtccacaggagagggctttgggctgtccccgctacgccccccgtcagtcctacccaca
cctgcacccgatggatccctcccctacctgtcccatggagcctcacagcgggcaggcatc
acctctccggtcgataagcgagaagacccaggggctggaatgggcggctctttggtggca
cctgaacttccaggtacccaggacccaagcctgtccagtctcagccaaacagaactggag
aagcagcgccagcgccagcgactccgggagttgctgattcggcagcagatccagcgcaac
accctgcggcaggagaaggagacagctgcagcagctgcaggagctgtggggcccccgggc
agctggggtgctgagcccagcagccctgcctttgagcagctgagtcgaggccagaccccc
ttcgccgggacccaggacaagagtagccttgtggggctgcccccaagcaagttggggggc
cccatcctggggccaggggcttttcctggtgatgaccgactctcccggccacctccacca
gccaccccttcttctctggatgtgaatagccggcaactggtgggaggctcccaagccttc
tatcagcgagcgccctaccctgggtccctgcccttacagcagcagcagcagcagcagcaa
ctgtggcagcagcagcagcagcaacagcagcaggcaacggcagccacttccatgcgactt
gccatgtctactcgctttccgtcaactcctgggcctgaactgggccgcccagccctgggt
tcccccttggcgggacttcccactcgcctgcctggccccggagagccagtgcctggtcca
gctggtcctgcccagttcattgagttgcggcacaatgtccagaagggactaggacctggg
ggggctccatttcctggtcagggcccccctcagagaccccgtttttacccagtaagtgag
gactcccaccgaatggctcctgaagggcttcgaggcctcgcggtatcaggccttccccca
cagaaaccctcagcacccccggcccctgaattgaacaacagcgtccatccaataccccac
accaaaggtccctccctgcccaccagcttggagctggttagccggcccccctcaagcact
gagcttggccgtcctcctcctctggccctggaagctgggaagttaccctgcgaggatcct
gagctggacgatgagtttgatgcccacaaggccctagaggatgatgaggagcttgctcac
ctaggcctgggtgtggatgtggccaagggagatgatgagctgggcaccttggaaaacctg
gagaccaatgatccccacctggatgacctgctcaacggggatgagtttgatctactggcc
tacactgatcctgagctggacactggggacaaaaaggacatcttcaatgagcacctaagg
ctggtggaatcggccaatgaaaaggcagagcgggaggcccttctgcggggggtggagcca
gtatccttgggccctgaggaacgccctccacctgctgctgatgcctctgagccccgtctg
gcatcagtgcttccagaggtgaagcccaaggtggaggaaggtgggcgccacccttcccct
tgccaatttgccattaccacccccaaggtagagccggcacctgctaccacttccctaagc
ctggggctgaagccaggtcagagcgttatgggcagccgggacacccggatgggcacagga
cccttttccagcagtgggcacacaactgagaagggcccctttggggccacgggaggacca
ccagctcacctgttgacccccagcccgctgagtggcccaggagggtcctctctgctggaa
aagtttgagctggagagtgaggccctgaccttgcccggtggccatactgcatctggggat
gagctggacaagatggagagctcgctggtagccagtgagttgcccttacttatcgaggac
ctgttggagcatgagaagaaggagctccagaagaagcagcagctttccgcacagctgcag
cctgttcagcagcagcagcagcagcaacagcaacaacagcaacattccttgctgtctgca
ccaggccctgcccaggccatgtctttgccacacgagggctcttctcccagtttgtctgga
ccccaacagcagcttgccctaggacttggaggttcgcgacagccaggcttggcgcaacca
ctgatgcccacccagccaccagcacatgccctgcagcaacgtctggccccatccatggcc
atggtatccaatcaagggcatatgctaagtgggcagcatggagggcaggcaggcttggtg
ccccagcagagctcccagccagtgctggcacagaagcccatgggtaccatgccaccttct
atgtgtatgaaacctcagcagctggccatgcagcagcaactggctaacagcttcttcccg
gatacagatctggacaaatttgcggcagaagatatcattgatcccattgcaaaggccaag
atggtggctttgaaaggcatcaagaaggtgatggctcagggcagcattggagtggcacct
ggtatgaacaggcagcaagtgtccctgctagcccagaggctctcaggggggcccggcagt
gatctgcagaaccatgtggcagctggaagtggccaggagcggagtgctggtgacccctcc
cagcctcgtcccaacccgcccacctttgcccagggagtgatcaatgaggctgaccagcgg
cagtatgaggaatggctgtttcatacccaacagctcctacagatgcagctgaaggtgcta
gaggagcagattggtgtgcaccgcaagtctcggaaggctctgtgcgccaagcagcgcact
gccaaaaaggctggtcgtgagttcccggaggctgatgccgagaagctcaagctggtgacg
gagcagcagagcaagatccagaaacagctggatcaggtccggaagcagcagaaggagcac
accaatctcatggcagagtatcggaataagcagcagcagcagcagcagcagcaacaacag
cagcagcagcaacactcagctgtgctggcccttagcccttcccagagtccccggctactc
accaagctccctggtcagctgctcccgggccatgggctgcagccaccacaggggcctccg
ggtgggcaagctacaggtcttcgcctgcccccaggaggcatgacactccctggacagcct
ggtggccctttcctcaacacctccctggcccaacagcagcaacagcaacactctggtgga
gctggggccttggggggcccctcagggggctttttcccaggcaacctggctcttcgaggc
ctaggacccgattcaagacttttacaggaaaggcagctgcagctccagcagcagcgcatg
caactagcccagaaactgcaacagcagcagcaacagcacctcttaggacaggtggcagtc
cagcagcaacagcagcagagcctgggtgtacaggcaaaccaggctctgggtcccaaaccc
caggggcttctgcctcccagcagccgtcagggcctcttggtccaacagctgtccccacaa
ccaccccaggggccccagggcatgctgggccctgcccaggtagcagtgttgcagcaacag
cagcagcagcaacaccctggagccttgggcccccagggtcctcacagacaggtgcttctg
acccagtcccgggtgctgagttccccccagctggcacagcagggtcagggcctcatggga
caccggctggtcacagcccagcagcagcagcagcagcaacagcagcaacagcagcaacag
caccaacagcagggatccatggcaggcctttcccatctgcagcagggcctgatgccacac
ggcgggcagcccaaactcagcactcagcccatggccgccttgcagcagcagcagctccag
cagcagcagcagcagcagcagcagcagctccaacagcaacagcagcagcagcagcaactc
caacagcaacagcagcagcagctccaacagcaacagcagcagcaactgcaacagcagcaa
ttacagcagcagcagcagtttcagcagcagcagcagcaactacagcaacagcagcagcag
caatttcagcagcagcagcaacagcagcagcagcagcagcaacagcagcaacagcagatg
ggcctcttgaaccagagtcgaactttactgtctccacagcagcagcagccgcagcagcca
cagcagcaggtgccccttggccccggcatgcccgccaagccctcacaacacttttctagc
cctggagccctgggtaccactgtcctgctgacaggcaaggagcagagcatggtagagaca
gctcttcctccagaggccacggaggggccatccacacatcagggggcaccgctagcccta
gggactgttcctgagtcggcagccactgaacctggggaggtgaagccctcactctccggg
gactcacagctcctgcttgtccagccgcagacccagccacaacccagctctgcgcagctg
cagccacctctgaggctcccggggccacagcagcagcaagttaacttgctccacacagcc
actgtgggaagccatgggcaagcaggcagcggctcatcctcggaggcctcacccatgccc
cacctgctggcccaatcctctgttcctttaggggagcagcctgggaccatgacccagaac
cttctgggctcccaacagccccttggactagagcggccggtgcagaataatgccgggccg
cagcctgccaaagcaggatctgtcccccagtctggaccgggcctgcctgggcctggagtc
atgccgacagtgggtcagcttcgagcgcagctccaaggagtcctggccaaaaacccccag
ttgcggcacttgagcccgcagcagcagcagcagctacaggcactcctcatgcagcggcaa
ctgcagcagagtcaggcagtgcgccaggccccaccctaccaggaacccggagcccagccc
tctcccctccagggcctcctgggccgccagccccaacttgggggcttccctggatcccaa
acaggccccctccaggagctaggggtggggcttcgacctcagggcccaccccggctcccc
gccccacaaggagccttagccacaggaccggtcctcggccctgtccatcccactcctcca
ccatccagcccccaagagccaaagagaccttcctcacagccccccggagccagccccctg
gtcccatcccagctcccttctgaggcccagctccctcccacccagccagggaccccaaaa
ccccaggggccatccttggagctgcctcctgggagggtctcacctgctgctgcccagctt
gcggatacgttcttcggcaaggggctgggaccttgggaccctccagacagcctagtagaa
gcccagaagccagagcagagcagcctggtacctgggcatctggagcaggtgaatgggcag
gcagtgcctgagccaccccatctcagcatcaagcaggagcctcgggaagagccatgtgcc
ctgggagcccaggcggtgaagagggaggccaacggggagccaataggggcaccaggtacc
agcaaccacctcctgctggcaggcccccgttcagaggccgggcatctgctcttgcagaag
cttctacgggcaaagaatgtgcaactcagcactgggcgggggcccgaggggctgcgagct
gagatcaacgggcacattgacagcaagctggctgggctggagcagaaactacagggtacc
cccagcaacaaggaggatacagcagcaaggaagcctgtgacaccgaagcccaagcgggta
cagaaggcaagcgacaggttggtgagctcccgaaagaagctgcggaaggaggacggggtc
agggccagcgaggccttgctgaaacagctgaaacaggagctgtccctgctgcccctaacg
gagcctaccatcaccgccaattttagcctctttgctcccttcggcagtggctgcccagtc
aacgggcagtgccagctgaggggggcctttggaagtggggcactgcccactggccctgac
tactattcccagctgcttaccaagaataacctgagtaacccgccgacaccaccctcgtcg
ctgccccccaccccacccccatcggtgcagcagaagatggtgaatggcgtcactccatcc
gaagagctgggggagcaccccaaggatgctgcctctgcccgggatactgaagggacgctg
agggatgcttcagaggtgaagagtctagacctgctggccgccttgcctacaccccctcac
aatcagactgaggatgtcaggatggaaagtgacgaggacagcgattctcctgatagcatt
gtgccagcttcgtcccccgaaagcatcctaggggaggaggcacctcgtttccctcagctg
ggctcaggccggtgggagcaggaagaccgggctctctcccctgttatccccataattcct
cgggccagtatcccagtcttcccagataccaaaccttatggggccctggacctggagacc
tctggaaagctgcctgccacaacttgggaaaagggcaaaggaagtgaggtgtcggtcatg
ctgacggtctctgctgctgcggccaagaacctgaatggtgtgatggtggcagtggcagag
ctgctaagcatgaagatccccaactcctatgaggtgctgttcccagagagccctgcccgg
gcaggcattgagcctaagaagggggaagctgagggccctggagggaaagaaaagggtctg
ggaggcaagagcccggaagctggccctgattggctgaaacagtttgatgcagtgttgcct
ggctataccctcaagagccagctagacatcctgagcctcctgaaacaggagagccctgcc
ccagagccccccacccaacacagctacacctacaacgtctccaatctggatgtgcgacag
ctctcggccccacctcctgaggaaccctccccgcccccgtcccccttggcaccctctcct
gccagcccccctgctgagcccctggttgaactcccggctgaaccctcagctgagccacca
gtcccatcgcctctgccactggcctcgtcccctgagtcagcccgacccaagcctcgagcc
cggccccctgaagaaggtgaagattcccggccccctcgcctcaagaagtggaaaggggtg
cgctggaagcggctgcggctgctgctgaccatccagaagggcagtgggcggcaggaggac
gagcgggaagtggcggagtttatggaacagctcggcacagccctgcgacccgacaaggtg
cctcgtgatatgcggcgctgctgcttctgtcatgaggagggtgacggggccactgatggg
ccggcgcgcctgctgaacctggacctggacctgtgggtgcacctcaactgtgccctgtgg
tccacagaggtgtacgagacccagggtggggcgctgatgaacgttgaggtcgccctgcac
cgagggctgctcaccaagtgctccctgtgccagcgcaccggcgccaccagcagctgcaat
cgaatgcgttgccccaacgtctaccattttgcctgcgccatccgcgccaagtgcatgttc
ttcaaggacaagaccatgctgtgtccaatgcataagatcaaggggccctgtgaacaggag
ctgagctcttttgctgtcttccggcgggtctacattgagcgggatgaggtgaagcaaatc
gccagcatcatccagcggggagagcggctacacatgttccgcgtggggggccttgtgttc
cacgccatcggacagctgctccctcatcagatggctgacttccacagtgccactgccctc
tatcccgttggctatgaggccacgcgcatctattggagcctccgcaccaacaaccgccgc
tgctgctaccgctgctccatcggcgagaacaacggaaggccagagttcgtcatcaaagtc
atggagcagggcctggaggacctggtcttcacggatgcctccccccaggctgtgtggaac
cgcatcatcgagcctgtggccgccatgagaaaagaggccgacatgctgcggctcttcccc
gagtacctgaagggcgaggagctcttcgggctgacggtgcacgccgtgctgcgcatagct
gaatcactgcctggagtggagagctgtcaaaactatttattccgctacggacgccacccc
ctgatggagctgccactcatgatcaatcccactggttgtgcccgatcggagcctaaaatc
ctcacacactacaaacggcctcacaccctgaacagcaccagcatgtccaaggcatatcag
agcaccttcacaggcgagaccaacaccccatacagtaagcagtttgtgcactccaagtca
tcacagtaccggcgcctgcgcactgagtggaagaacaacgtgtacctggctcgctcccgt
atccagggcctggggctctatgccgccaaggacctagaaaagcacacaatggtcatcgaa
tatattggcaccatcattcgcaatgaggtggccaaccggcgggagaaaatctatgaggag
cagaatcgcggcatctacatgttccgaataaacaacgaacatgtaattgatgctacgttg
accggaggccctgccaggtacattaaccattcctgtgcccctaactgtgtggcggaagtt
gtgacatttgacaaggaggataaaatcatcatcatctccagccggcgaatccccaaagga
gaggagctgacctatgactatcagtttgactttgaggacgatcagcacaagattccctgc
cactgtggagcctggaactgtcggaaatggatgaactaa

DBGET integrated database retrieval system