KEGG   Canis familiaris (dog): 486558Help
Entry
486558            CDS       T01007                                 

Gene name
KMT2D, MLL2
Definition
(RefSeq) lysine (K)-specific methyltransferase 2D
  KO
K09187  
histone-lysine N-methyltransferase MLL2 [EC:2.1.1.43]
Organism
cfa  Canis familiaris (dog)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    486558 (KMT2D)
Enzymes [BR:cfa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     486558 (KMT2D)
Transcription factors [BR:cfa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    486558 (KMT2D)
Chromosome [BR:cfa03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     486558 (KMT2D)
   HMT complexes
    MLL-HCF complex
     486558 (KMT2D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
27
AA seq 5669 aa AA seqDB search
MDSQKPPGEDKDSEPAADGPAASEESGTTEPDLPNPYVGEVSVPSSGGPRLQEPPRDCSG
GPVRRCALCNCGEPSLHGQRELRRFELPFDWPQCPVVSPGGNPGPNEAVLPSEDLSQIGF
PEGLTPAHLGEPGGSCWAHHWCAAWSAGVWGQEGPELCGVDKAIFSGISQRCSHCTRLGA
SIPCRSPGCPRLYHFPCATASGSFLSMKTLQLLCPEHSEGAAHLEEARCAVCEGPGELCD
LFFCTSCGHHYHGACLDTALTARKRAGWQCPECKVCQACRKPGNDSKMLVCETCDKGYHT
FCLKPPMEELPAHSWKCKACRVCRACGAGSAELNPNSEWFENYSLCHRCHKAQGGQLIGS
VAEQHPPVCSRFSPLEPGDTPTDEPKALYVACQGQPKGGHVTSMQPKEPGPLQCEAKPLG
RAGAQLEPRLEVPLNEEMPLLPPPEESPLSPPPEESPTSPPPEASRLSPPPEESPLSPPP
EESPLSPPPESSPFSPLEESPFSPPEESPPSPPLETPLSPPPEASPLSPPFEESPLSPPP
EELPTSPPPEASRLSPPPEESPMSPPPEESPMSPPPEASRLFPPFEESPLSPPPEESPLS
PPPEASRLSPPPEDSPMSPPPEDSPVSPPPEVSCLSSLPEVSRLSPPPEESPLSPPPEES
PTSPPPEASRLFPPPEDSPTSPPPEDSPASPPPEDLLMTLPLEESSLLPLPEEPRLCPLP
EEPRLPPQPEEPRLSPRPEEPRLSPQPEEPRLSPRPEEPRLSPQPEEPRLSPALEEPCLS
PAPEELRLPLWLEEPRLSPRPEKPCLSPAPEELHLSPRPEEPRLSPRPEEPRLSPRPEEP
RLSPQPEEPRLSPRSEEPCLSPAPEEPRLSPMPEEPQLSPRPEEPPLSPMPEEPPLSPGP
EEPRLSPGPEEPRLSPRPEEPRPSPQPEEPRLSLGPEEPRLSPRPEEPCLSPRPEEPRLS
PRPEEPPEEPGLCPAPEELPLFLPPGEPSLSPLLGEPALSEPGEPPLSPLPEELPLSPSG
EPSLSPQLMPPDPLPPPLSPIITTVAPPALSPLGELEYPFGAKGDSDPESPLAAPILETP
ISPPPEANCTDPEPVPPMILPPSPGSPMGPASPILMEPLPSRCSPLLQPSLPPQNSPPSQ
CSLPALPLSVPSPLSPMEKAVEVSDEAEPHEMETEKVPEPECPALEPSPTSPLPSPMGNL
SCPAPSPAPALDDFSGLGEDTAPLDGTDTPGSQPEAGQTPGSLASELKGSPVLLDPEELA
PVTPMEVYGPEGKQAGQGSPCEEQEEPRVPVAPTPPTLIKSDIVNEISNLSQGDASASFP
GSEPLLGSPDPEGGGSLSMELGVSTDVSPARDEGSLRLCTDSLPETDDSLLCDAGTAIGG
GKAEGDKGRRRSSPARSRIKQGRSSSFPGRRRPRGGAHGGRGRGRARLKSTTSSIETLVV
ADIDSSPSKEEEDDDDDTMQNTVVLFSNTDKFVLMQDMCVVCGSFGRGAEGHLLACSQCS
QCYHPYCVNSKITKVMLLKGWRCVECIVCEVCGQASDPSRLLLCDDCDISYHTYCLDPPL
LTVPKGGWKCKWCVSCMQCGAASPGFHCEWQNSYTHCGPCASLVTCPICHTPYVEEDLLI
QCRHCERWMHAGCESLFTEDDVEQAADEGFDCVSCQPYVVKPAAPVAPPELVPMKVKEPE
PQYFRFEGVWLTETGMAVLRNLTMSPLHKRRQRRGRLGLPGEAGLEGSEPSDALGPDDKK
DGDLDTDELLKGEGGVEHMECEMKLEGPVSPDVEPGREETEESKKRKRKPYRPGIGGFMV
RQRKSHTRVKKGPAAQAEVLSGDGQPDEVMPVDLPVEGPVDQSLADGDEKKKQQRRGRKK
SKLEDMFPAYLQEAFFGKELLDLSRKALFAVGMGRPTFGLGTPKAKGDGGSDRKELPTSQ
KGDDGPDVADEESRGPEGKADTPGPEDGGVKASPVPSDPEKPGTPGEGMLSSDLDRIPTE
ELPKMESKDLQQLFKDVLGSEREQHLGCGTPGPDGSRTPLQRPFLQGGLPLGNLPSSSPM
DSYPGLCQSPFLDSRERGGFFSPEPGEPDSPWTGSGGTTPSTPTTPTTEGEGDGLSYNQR
SLQRWEKDEELGQLSTISPVLYANINFPNLKQDYPDWSSRCKQIMKLWRKVPAADKAPYL
QKAKDNRAAHRINKVQKQAESQINKQTKVGDMARKTDRPALHLRIPPQPGALGSPPPAAA
PTIFIGSPTTPAGLSTSADGFLKPPVGTVPGPDSPGELFLKLPPQVPAQVPSQDPFGLAP
AYALEPRFPTAPPTYPPYPSPTGAPAPPLTLGASSRPGTGQPGEFHTTPPGTPRHQPSTP
DPFLKPRCPSLDNLAVPESPGIGGGKAAEPLLSPPPFGESRKALEVKKEELGASSPSYGP
PNLGFVDSPSSGPHLGSLELKAPDVFKAPLTPRASQVEPQSPGLGLRPQEPPPAQALAPS
SPSHSDIFRPGPYPDPYAQPPLTPRPQPPPPESCCALPPRSLPSDPFSRVPASPQSQSSS
QSPLTPRPLSAEAFCPSPVTPRFQSPDPYSRPPSRPQSRDPFAPLHKPPRPQPPEVAFKA
GPLAHTPLGAGGFPAALPSGPTGELHAKVPSGQPPNFARSPGTGAFVGTPSPMRFTFPQA
VGEPSLKPPVPQPGLPPPHGINSHFGPGPTLGKPQSTNYAVATGNFHPSGSPLGSSSGST
GEGFGLSPLRPPSVLPTPAPDGSLPYLSHGASQRAGITSPVDKREDPGAGMGGSLVAPEL
PGTQDPSLSSLSQTELEKQRQRQRLRELLIRQQIQRNTLRQEKETAAAAAGAVGPPGSWG
AEPSSPAFEQLSRGQTPFAGTQDKSSLVGLPPSKLGGPILGPGAFPGDDRLSRPPPPATP
SSLDVNSRQLVGGSQAFYQRAPYPGSLPLQQQQQQQQLWQQQQQQQQQATAATSMRLAMS
TRFPSTPGPELGRPALGSPLAGLPTRLPGPGEPVPGPAGPAQFIELRHNVQKGLGPGGAP
FPGQGPPQRPRFYPVSEDSHRMAPEGLRGLAVSGLPPQKPSAPPAPELNNSVHPIPHTKG
PSLPTSLELVSRPPSSTELGRPPPLALEAGKLPCEDPELDDEFDAHKALEDDEELAHLGL
GVDVAKGDDELGTLENLETNDPHLDDLLNGDEFDLLAYTDPELDTGDKKDIFNEHLRLVE
SANEKAEREALLRGVEPVSLGPEERPPPAADASEPRLASVLPEVKPKVEEGGRHPSPCQF
AITTPKVEPAPATTSLSLGLKPGQSVMGSRDTRMGTGPFSSSGHTTEKGPFGATGGPPAH
LLTPSPLSGPGGSSLLEKFELESEALTLPGGHTASGDELDKMESSLVASELPLLIEDLLE
HEKKELQKKQQLSAQLQPVQQQQQQQQQQQQHSLLSAPGPAQAMSLPHEGSSPSLSGPQQ
QLALGLGGSRQPGLAQPLMPTQPPAHALQQRLAPSMAMVSNQGHMLSGQHGGQAGLVPQQ
SSQPVLAQKPMGTMPPSMCMKPQQLAMQQQLANSFFPDTDLDKFAAEDIIDPIAKAKMVA
LKGIKKVMAQGSIGVAPGMNRQQVSLLAQRLSGGPGSDLQNHVAAGSGQERSAGDPSQPR
PNPPTFAQGVINEADQRQYEEWLFHTQQLLQMQLKVLEEQIGVHRKSRKALCAKQRTAKK
AGREFPEADAEKLKLVTEQQSKIQKQLDQVRKQQKEHTNLMAEYRNKQQQQQQQQQQQQQ
QHSAVLALSPSQSPRLLTKLPGQLLPGHGLQPPQGPPGGQATGLRLPPGGMTLPGQPGGP
FLNTSLAQQQQQQHSGGAGALGGPSGGFFPGNLALRGLGPDSRLLQERQLQLQQQRMQLA
QKLQQQQQQHLLGQVAVQQQQQQSLGVQANQALGPKPQGLLPPSSRQGLLVQQLSPQPPQ
GPQGMLGPAQVAVLQQQQQQQHPGALGPQGPHRQVLLTQSRVLSSPQLAQQGQGLMGHRL
VTAQQQQQQQQQQQQQQHQQQGSMAGLSHLQQGLMPHGGQPKLSTQPMAALQQQQLQQQQ
QQQQQQLQQQQQQQQQLQQQQQQQLQQQQQQQLQQQQLQQQQQFQQQQQQLQQQQQQQFQ
QQQQQQQQQQQQQQQQMGLLNQSRTLLSPQQQQPQQPQQQVPLGPGMPAKPSQHFSSPGA
LGTTVLLTGKEQSMVETALPPEATEGPSTHQGAPLALGTVPESAATEPGEVKPSLSGDSQ
LLLVQPQTQPQPSSAQLQPPLRLPGPQQQQVNLLHTATVGSHGQAGSGSSSEASPMPHLL
AQSSVPLGEQPGTMTQNLLGSQQPLGLERPVQNNAGPQPAKAGSVPQSGPGLPGPGVMPT
VGQLRAQLQGVLAKNPQLRHLSPQQQQQLQALLMQRQLQQSQAVRQAPPYQEPGAQPSPL
QGLLGRQPQLGGFPGSQTGPLQELGVGLRPQGPPRLPAPQGALATGPVLGPVHPTPPPSS
PQEPKRPSSQPPGASPLVPSQLPSEAQLPPTQPGTPKPQGPSLELPPGRVSPAAAQLADT
FFGKGLGPWDPPDSLVEAQKPEQSSLVPGHLEQVNGQAVPEPPHLSIKQEPREEPCALGA
QAVKREANGEPIGAPGTSNHLLLAGPRSEAGHLLLQKLLRAKNVQLSTGRGPEGLRAEIN
GHIDSKLAGLEQKLQGTPSNKEDTAARKPVTPKPKRVQKASDRLVSSRKKLRKEDGVRAS
EALLKQLKQELSLLPLTEPTITANFSLFAPFGSGCPVNGQCQLRGAFGSGALPTGPDYYS
QLLTKNNLSNPPTPPSSLPPTPPPSVQQKMVNGVTPSEELGEHPKDAASARDTEGTLRDA
SEVKSLDLLAALPTPPHNQTEDVRMESDEDSDSPDSIVPASSPESILGEEAPRFPQLGSG
RWEQEDRALSPVIPIIPRASIPVFPDTKPYGALDLETSGKLPATTWEKGKGSEVSVMLTV
SAAAAKNLNGVMVAVAELLSMKIPNSYEVLFPESPARAGIEPKKGEAEGPGGKEKGLGGK
SPEAGPDWLKQFDAVLPGYTLKSQLDILSLLKQESPAPEPPTQHSYTYNVSNLDVRQLSA
PPPEEPSPPPSPLAPSPASPPAEPLVELPAEPSAEPPVPSPLPLASSPESARPKPRARPP
EEGEDSRPPRLKKWKGVRWKRLRLLLTIQKGSGRQEDEREVAEFMEQLGTALRPDKVPRD
MRRCCFCHEEGDGATDGPARLLNLDLDLWVHLNCALWSTEVYETQGGALMNVEVALHRGL
LTKCSLCQRTGATSSCNRMRCPNVYHFACAIRAKCMFFKDKTMLCPMHKIKGPCEQELSS
FAVFRRVYIERDEVKQIASIIQRGERLHMFRVGGLVFHAIGQLLPHQMADFHSATALYPV
GYEATRIYWSLRTNNRRCCYRCSIGENNGRPEFVIKVMEQGLEDLVFTDASPQAVWNRII
EPVAAMRKEADMLRLFPEYLKGEELFGLTVHAVLRIAESLPGVESCQNYLFRYGRHPLME
LPLMINPTGCARSEPKILTHYKRPHTLNSTSMSKAYQSTFTGETNTPYSKQFVHSKSSQY
RRLRTEWKNNVYLARSRIQGLGLYAAKDLEKHTMVIEYIGTIIRNEVANRREKIYEEQNR
GIYMFRINNEHVIDATLTGGPARYINHSCAPNCVAEVVTFDKEDKIIIISSRRIPKGEEL
TYDYQFDFEDDQHKIPCHCGAWNCRKWMN
NT seq 17010 nt NT seq  +upstreamnt  +downstreamnt
atggacagccagaagccgcctggtgaggataaagattcagaaccggcagctgatggacct
gcagcctctgaggagtcaggcaccactgagccagaccttcccaacccatatgtgggggag
gtctctgtgcccagttctggaggtcctaggcttcaggagcctccccgggactgcagtggg
ggtccagtgcggcgttgtgctctctgtaactgcggggagcctagtctacatgggcagcgg
gaactacggcgctttgagttgccatttgactggccccagtgtccagtggtgtcccctggg
gggaacccagggcccaacgaggcagtgctgcccagtgaggacctgtcacagattggtttc
cctgagggcctgacacctgcccacctaggagaacctggagggtcctgctgggctcaccat
tggtgtgctgcgtggtcggcaggtgtatgggggcaggagggcccagaactatgtggtgtg
gacaaggccatcttctcagggatctcacagcgctgctcccactgcaccaggctcggtgcc
tccatcccttgccgctcacccggatgtccacggctttaccacttcccttgtgcgactgcc
agcggttccttcttatccatgaaaacactgcagctgctatgcccggagcacagtgagggg
gctgcacatctggaggaggctcgttgtgcagtatgcgaggggccaggggagttgtgtgac
ctgttcttctgtaccagttgtgggcatcactatcacggggcctgcctggacactgctctt
accgcccgcaagcgtgctggctggcagtgccctgaatgcaaagtgtgccaagcctgcagg
aaacctgggaatgactctaagatgttggtctgtgagacgtgtgacaaaggataccatacc
ttctgcctcaagccaccaatggaggaattgccagctcactcttggaagtgcaaggcatgc
cgggtatgccgggcctgtggggcaggctcagcggagctgaatcccaactctgagtggttt
gaaaactactcactctgtcaccgctgtcacaaggcccagggaggacagcttattggttct
gtggctgagcagcatccccctgtctgcagcaggttctcacccctagagcctggcgatacc
cccactgacgagcccaaagctctgtacgttgcatgccaagggcagccaaagggtgggcac
gtgacctccatgcaacccaaggaaccggggcccctgcaatgtgaagccaaaccactaggg
agagcaggggcccaacttgagccccggttggaggtccccctaaacgaggagatgccactg
ctgcccccacctgaggagtcgcccctctccccaccacctgaggaatcgcccacatcccca
ccacctgaggcatcgcgtctgtccccaccaccggaggaatcacccctctctccgccgcct
gaggagtctcctctgtctcctccacctgaatcatcacctttttctccactggaggagtcg
ccgttctctccaccagaggagtcacccccatctcccccacttgagacgcccctgtctcca
ccgcctgaagcatcacccctctccccaccatttgaagagtctcccttatcccccccacct
gaggagttgcccacttccccgccacctgaagcatctcgcctgtctccaccacctgaggag
tcacccatgtccccgccacctgaagagtcacccatgtctccgccacctgaagcatctcgt
ctgttcccaccatttgaagaatcgcccctgtcccctccaccagaggagtctcccctctcc
ccaccacctgaggcatcccgtctgtccccacctcctgaggactcgcctatgtccccacca
cctgaagactcgcctgtgtcccccccacctgaggtatcctgcctgtcctccctgcctgag
gtgtcacgcctgtccccaccacctgaggaatctcccctgtccccaccacccgaagagtcc
cccacatcccctccacctgaggcttcccgcctgttcccaccacctgaggactccccgact
tccccgccgcctgaagactcacctgcttctccgccaccggaggacttactcatgacccta
ccgctagaggagtcatccctgttgccactgcccgaggagccacgactctgccccctgccc
gaggagccgcgcctgccccctcagcccgaggagccgcgcctgtcccctcggcctgaggag
ccgcgcctgtcccctcagcccgaggagccacgcctgtcccctcggcccgaggagccgcgc
ctgtcccctcagcctgaggagccgcgcctgtcccccgcacttgaggaaccatgcctgtcc
cccgcgcctgaggagctgcgcctgcccctttggcttgaggagccacgtctgtccccccgg
cctgagaagccatgcctgtcccctgcccctgaggagctgcacctgtccccccggcctgag
gagccgcgcctgtccccccggcctgaggaaccgcgcctgtccccccggcctgaggaaccg
cgcctgtcccctcagcctgaggagccgcgcctgtccccccggtctgaggagccgtgcctg
tcccccgcgcctgaggagccacgcctgtcccccatgcctgaggagccgcagttgtctccc
cggcctgaggagccgcccctgtcccccatgcctgaggagccgcccctgtcccccgggcct
gaggagccgcgcctgtcccccgggcctgaggagccgcgcctgtccccccggcctgaggag
ccacgcccgtcccctcaacctgaggaaccgcgcctgtcccttggacctgaggaaccgcgc
ctgtcccctcgacctgaggaaccgtgcctgtcccctcgacctgaggaaccgcgcctgtcc
cctcgacctgaagagccccctgaggagccaggcctatgccctgcacctgaggaattgccc
ttgttcctcccacctggggagccatctttatcccccttgcttggagagccggccctgtct
gagcctggggaaccacctctgtcccctctaccagaggagttgccgttgtccccatccggg
gagccatccttgtcacctcagctgatgccaccagatcctcttcctcctccgctctcaccc
attatcacaactgtggccccgccggctctgtctcctttgggggagttagaataccccttt
ggtgccaaaggggacagtgaccctgagtcgccgttggctgcccccatccttgagacgccc
atcagccctccaccagaagctaactgcactgaccctgagcctgtgccccctatgatcctc
cccccatctccaggctccccaatgggaccagcctctcccatcctgatggagccccttccc
tctcggtgttctccactcctgcaaccttcccttcctccccaaaactctcctccttcccaa
tgttctcttcctgctctgccattgtccgttccctccccactgagtcccatggagaaggca
gtggaggtctcagatgaggctgagccgcatgagatggagactgagaaagtcccagaacct
gagtgtccagccttggaacccagccccactagtcctctcccctcgcccatggggaacctt
tcctgccccgcacccagccctgccccagctctggatgacttctctggtctgggggaagac
acagcccctctggatgggactgacactcctggttcacagccagaggctggacagacccct
ggcagtttggctagtgaacttaagggttcccctgtgctcctggaccccgaggagctggcc
cccgtgacccctatggaggtctatggcccagaaggcaagcaggcagggcagggttcaccc
tgtgaagagcaagaggagccacgtgtaccggtggcccctaccccacccactctcatcaaa
tccgacatcgttaatgagatctctaatctgagccagggtgatgccagtgccagttttcct
ggctcagagcccctgctaggctctcccgaccccgaggggggcggctccttgtccatggag
ctgggggtatctacagacgttagtccagcccgggatgagggctccctgcggctctgtact
gactcgctgccagagactgacgactcgctactatgtgatgctgggacagcaattggcgga
ggcaaagccgagggggacaaggggaggcggcgcagctccccggctcgttcccgcatcaaa
cagggtcgcagcagtagtttcccaggaagacgccggccacgtggaggagcccatggagga
cgtgggagaggacgggcccggctaaaatcaactacttcttccattgagactctggtagtt
gctgatatcgatagctctcccagcaaagaggaagaagacgacgatgacgacaccatgcaa
aatactgtggttctcttctccaacacagacaagtttgtcctaatgcaggacatgtgcgtg
gtttgtggcagctttggccggggggcagagggccacctccttgcctgttcccagtgttcc
cagtgctatcacccttactgtgtcaacagcaagatcaccaaggtgatgctgctaaagggc
tggcgttgcgtggagtgcatcgtgtgtgaggtgtgtggccaagcctcggacccctcacgc
ctgctgctctgtgatgactgtgacattagctaccacacatactgcctggacccgccactg
ctcaccgtgcccaaggggggctggaagtgcaagtggtgtgtgtcttgtatgcagtgtggg
gccgcctcccctggcttccactgtgaatggcaaaatagttacacacactgcggcccctgc
gccagcctggtgacctgccctatctgtcacaccccatacgtggaagaggacctactaatc
cagtgccgccactgtgaacggtggatgcatgctggctgcgagagcctcttcacggaggat
gacgtggagcaggcggccgatgagggctttgactgtgtctcctgccagccctatgtagta
aagcctgctgcacctgtcgcacctccagagttggtgcctatgaaggtgaaagagccagag
cctcaatactttcgcttcgagggcgtgtggctgacagaaacgggcatggctgtgctgcgt
aaccttaccatgtcacccctgcacaagcggcgccagcggcgaggacggcttggcctccca
ggcgaggcagggctggagggttctgagccctcagatgcccttggtcctgatgacaagaag
gatggggacctggacactgatgagctgctcaagggtgaaggtggcgtggagcacatggaa
tgtgaaatgaaactggagggccctgtcagccctgacgtggagcctggcagagaggaaact
gaggaaagcaagaaacgcaaacgcaaaccctatcggcctggcatcggtggtttcatggtg
cgacagcggaaatcccacacacgtgtgaaaaaggggcctgctgcacaggcggaggtgttg
agtggggatgggcagcccgacgaggtgatgcctgtggacctgcctgttgagggccctgtg
gaccagagcttagctgatggggatgagaaaaagaagcagcagaggcgagggcgcaagaag
agcaaactggaagacatgtttcctgcttatttgcaggaagccttctttgggaaggagctg
ttggacctgagccggaaggccctttttgcagttgggatgggccggccaacttttggccta
ggaaccccaaaagccaaaggggatggaggctcagataggaaggagctccccacctcacag
aaaggagatgatggtccggatgttgcagatgaagaatcccgtggccctgagggcaaggct
gatacaccaggacctgaggatggaggtgtgaaggcatccccagtgcccagtgaccccgag
aagcctggcactccgggtgaagggatgcttagctctgacttagataggattcccacggaa
gaactgcccaagatggaatccaaggacctgcagcagctcttcaaggatgttctgggttct
gaacgagagcagcacctgggttgcggaacccccggcccagatggcagccgtacaccgctg
cagaggccctttctccaaggtggactccctttgggcaatctcccctccagcagcccaatg
gactcctacccaggcctctgccagtccccatttctggattctagggagcgcgggggcttc
tttagcccggaacccggtgagccagacagcccctggacaggctcggggggcaccacgccc
tccacccccaccacccccaccacggagggtgagggcgacgggctctcctataaccagcgg
agccttcagcgctgggagaaggatgaggagttgggccagctctccaccatctcgcctgtg
ctctatgccaacattaactttcccaatctcaagcaggattacccagactggtctagccgt
tgcaaacaaatcatgaagctctggagaaaagttccagctgctgacaaagccccctacctg
caaaaggccaaagataaccgggcggctcaccgcatcaacaaggtgcaaaagcaggctgag
agccagatcaacaagcagaccaaggtgggcgacatggcccgtaagactgaccgaccagcc
ctacatctccgcattcccccccagccaggggcactgggcagtccgccccctgctgctgcc
cccaccattttcattggcagccccacaacccccgccggcttgtctacctctgcggacggg
ttcctgaagccgccagtgggcacagtgcccggccccgactcgcccggtgagctcttcctc
aagctcccaccccaggtgcccgcccaagtgccttcgcaggacccctttggactggccccc
gcctacgctctggagcctcgcttccccacggcaccacctacctatcctccctatcctagt
ccgactggggcccccgcgccgcctctgacgctgggcgcctcatctcgtcctgggactggc
cagccaggggaattccacactaccccacctggcaccccccgacaccagccctccacacct
gacccctttctcaaaccccgctgcccctcactggacaacctggctgtgcctgagagccca
gggatagggggaggcaaggctgccgaacccctgctgtcacccccaccttttggcgagtct
cggaaggccctagaggtgaagaaggaagagcttggggcatcctctccgagctacgggccc
ccaaacctaggctttgttgactcaccttcctcaggcccccacctgggcagcctggagtta
aaggcacccgatgtcttcaaagcccccctgacccctcgggcatctcaggtagagccccag
agcccgggcttgggcctaaggccccaagagccacctcctgcccaggctttggccccttct
tcccccagccactcggacatctttcgccctggcccttaccctgatccctatgcccagccg
ccattgacccctcggccccaacccccacctcctgagagctgctgtgccctgcctcctcgc
tcattgccctcagaccctttctcccgagtgcccgcgagtccccagtcccagtccagctcc
cagtctccgttaacaccccgtcctttgtctgccgaggctttttgcccatcccctgttacc
cctcgcttccagtcccctgacccctattcccgtcctccctcacgccctcagtcccgtgac
ccatttgcccccttgcataagccaccccgaccccagccccctgaagttgccttcaaggct
gggcctctagcccacactccactgggggctggcggcttcccagcagccctgccctcaggg
ccaacaggtgagctccatgctaaggtcccaagtggacagcccccaaatttcgcccggtcc
cctgggacgggtgcttttgtgggcaccccctctcccatgcgtttcactttccctcaggcg
gtaggggagccttccctaaagccccctgtccctcagcctggtctccctccaccccatggg
atcaacagccattttgggcctggccctaccttgggcaagcctcaaagcacaaactacgca
gtagccacagggaatttccacccatcgggcagccccctgggatccagcagcgggtccaca
ggagagggctttgggctgtccccgctacgccccccgtcagtcctacccacacctgcaccc
gatggatccctcccctacctgtcccatggagcctcacagcgggcaggcatcacctctccg
gtcgataagcgagaagacccaggggctggaatgggcggctctttggtggcacctgaactt
ccaggtacccaggacccaagcctgtccagtctcagccaaacagaactggagaagcagcgc
cagcgccagcgactccgggagttgctgattcggcagcagatccagcgcaacaccctgcgg
caggagaaggagacagctgcagcagctgcaggagctgtggggcccccgggcagctggggt
gctgagcccagcagccctgcctttgagcagctgagtcgaggccagacccccttcgccggg
acccaggacaagagtagccttgtggggctgcccccaagcaagttggggggccccatcctg
gggccaggggcttttcctggtgatgaccgactctcccggccacctccaccagccacccct
tcttctctggatgtgaatagccggcaactggtgggaggctcccaagccttctatcagcga
gcgccctaccctgggtccctgcccttacagcagcagcagcagcagcagcaactgtggcag
cagcagcagcagcaacagcagcaggcaacggcagccacttccatgcgacttgccatgtct
actcgctttccgtcaactcctgggcctgaactgggccgcccagccctgggttcccccttg
gcgggacttcccactcgcctgcctggccccggagagccagtgcctggtccagctggtcct
gcccagttcattgagttgcggcacaatgtccagaagggactaggacctgggggggctcca
tttcctggtcagggcccccctcagagaccccgtttttacccagtaagtgaggactcccac
cgaatggctcctgaagggcttcgaggcctcgcggtatcaggccttcccccacagaaaccc
tcagcacccccggcccctgaattgaacaacagcgtccatccaataccccacaccaaaggt
ccctccctgcccaccagcttggagctggttagccggcccccctcaagcactgagcttggc
cgtcctcctcctctggccctggaagctgggaagttaccctgcgaggatcctgagctggac
gatgagtttgatgcccacaaggccctagaggatgatgaggagcttgctcacctaggcctg
ggtgtggatgtggccaagggagatgatgagctgggcaccttggaaaacctggagaccaat
gatccccacctggatgacctgctcaacggggatgagtttgatctactggcctacactgat
cctgagctggacactggggacaaaaaggacatcttcaatgagcacctaaggctggtggaa
tcggccaatgaaaaggcagagcgggaggcccttctgcggggggtggagccagtatccttg
ggccctgaggaacgccctccacctgctgctgatgcctctgagccccgtctggcatcagtg
cttccagaggtgaagcccaaggtggaggaaggtgggcgccacccttccccttgccaattt
gccattaccacccccaaggtagagccggcacctgctaccacttccctaagcctggggctg
aagccaggtcagagcgttatgggcagccgggacacccggatgggcacaggacccttttcc
agcagtgggcacacaactgagaagggcccctttggggccacgggaggaccaccagctcac
ctgttgacccccagcccgctgagtggcccaggagggtcctctctgctggaaaagtttgag
ctggagagtgaggccctgaccttgcccggtggccatactgcatctggggatgagctggac
aagatggagagctcgctggtagccagtgagttgcccttacttatcgaggacctgttggag
catgagaagaaggagctccagaagaagcagcagctttccgcacagctgcagcctgttcag
cagcagcagcagcagcaacagcaacaacagcaacattccttgctgtctgcaccaggccct
gcccaggccatgtctttgccacacgagggctcttctcccagtttgtctggaccccaacag
cagcttgccctaggacttggaggttcgcgacagccaggcttggcgcaaccactgatgccc
acccagccaccagcacatgccctgcagcaacgtctggccccatccatggccatggtatcc
aatcaagggcatatgctaagtgggcagcatggagggcaggcaggcttggtgccccagcag
agctcccagccagtgctggcacagaagcccatgggtaccatgccaccttctatgtgtatg
aaacctcagcagctggccatgcagcagcaactggctaacagcttcttcccggatacagat
ctggacaaatttgcggcagaagatatcattgatcccattgcaaaggccaagatggtggct
ttgaaaggcatcaagaaggtgatggctcagggcagcattggagtggcacctggtatgaac
aggcagcaagtgtccctgctagcccagaggctctcaggggggcccggcagtgatctgcag
aaccatgtggcagctggaagtggccaggagcggagtgctggtgacccctcccagcctcgt
cccaacccgcccacctttgcccagggagtgatcaatgaggctgaccagcggcagtatgag
gaatggctgtttcatacccaacagctcctacagatgcagctgaaggtgctagaggagcag
attggtgtgcaccgcaagtctcggaaggctctgtgcgccaagcagcgcactgccaaaaag
gctggtcgtgagttcccggaggctgatgccgagaagctcaagctggtgacggagcagcag
agcaagatccagaaacagctggatcaggtccggaagcagcagaaggagcacaccaatctc
atggcagagtatcggaataagcagcagcagcagcagcagcagcaacaacagcagcagcag
caacactcagctgtgctggcccttagcccttcccagagtccccggctactcaccaagctc
cctggtcagctgctcccgggccatgggctgcagccaccacaggggcctccgggtgggcaa
gctacaggtcttcgcctgcccccaggaggcatgacactccctggacagcctggtggccct
ttcctcaacacctccctggcccaacagcagcaacagcaacactctggtggagctggggcc
ttggggggcccctcagggggctttttcccaggcaacctggctcttcgaggcctaggaccc
gattcaagacttttacaggaaaggcagctgcagctccagcagcagcgcatgcaactagcc
cagaaactgcaacagcagcagcaacagcacctcttaggacaggtggcagtccagcagcaa
cagcagcagagcctgggtgtacaggcaaaccaggctctgggtcccaaaccccaggggctt
ctgcctcccagcagccgtcagggcctcttggtccaacagctgtccccacaaccaccccag
gggccccagggcatgctgggccctgcccaggtagcagtgttgcagcaacagcagcagcag
caacaccctggagccttgggcccccagggtcctcacagacaggtgcttctgacccagtcc
cgggtgctgagttccccccagctggcacagcagggtcagggcctcatgggacaccggctg
gtcacagcccagcagcagcagcagcagcaacagcagcaacagcagcaacagcaccaacag
cagggatccatggcaggcctttcccatctgcagcagggcctgatgccacacggcgggcag
cccaaactcagcactcagcccatggccgccttgcagcagcagcagctccagcagcagcag
cagcagcagcagcagcagctccaacagcaacagcagcagcagcagcaactccaacagcaa
cagcagcagcagctccaacagcaacagcagcagcaactgcaacagcagcaattacagcag
cagcagcagtttcagcagcagcagcagcaactacagcaacagcagcagcagcaatttcag
cagcagcagcaacagcagcagcagcagcagcaacagcagcaacagcagatgggcctcttg
aaccagagtcgaactttactgtctccacagcagcagcagccgcagcagccacagcagcag
gtgccccttggccccggcatgcccgccaagccctcacaacacttttctagccctggagcc
ctgggtaccactgtcctgctgacaggcaaggagcagagcatggtagagacagctcttcct
ccagaggccacggaggggccatccacacatcagggggcaccgctagccctagggactgtt
cctgagtcggcagccactgaacctggggaggtgaagccctcactctccggggactcacag
ctcctgcttgtccagccgcagacccagccacaacccagctctgcgcagctgcagccacct
ctgaggctcccggggccacagcagcagcaagttaacttgctccacacagccactgtggga
agccatgggcaagcaggcagcggctcatcctcggaggcctcacccatgccccacctgctg
gcccaatcctctgttcctttaggggagcagcctgggaccatgacccagaaccttctgggc
tcccaacagccccttggactagagcggccggtgcagaataatgccgggccgcagcctgcc
aaagcaggatctgtcccccagtctggaccgggcctgcctgggcctggagtcatgccgaca
gtgggtcagcttcgagcgcagctccaaggagtcctggccaaaaacccccagttgcggcac
ttgagcccgcagcagcagcagcagctacaggcactcctcatgcagcggcaactgcagcag
agtcaggcagtgcgccaggccccaccctaccaggaacccggagcccagccctctcccctc
cagggcctcctgggccgccagccccaacttgggggcttccctggatcccaaacaggcccc
ctccaggagctaggggtggggcttcgacctcagggcccaccccggctccccgccccacaa
ggagccttagccacaggaccggtcctcggccctgtccatcccactcctccaccatccagc
ccccaagagccaaagagaccttcctcacagccccccggagccagccccctggtcccatcc
cagctcccttctgaggcccagctccctcccacccagccagggaccccaaaaccccagggg
ccatccttggagctgcctcctgggagggtctcacctgctgctgcccagcttgcggatacg
ttcttcggcaaggggctgggaccttgggaccctccagacagcctagtagaagcccagaag
ccagagcagagcagcctggtacctgggcatctggagcaggtgaatgggcaggcagtgcct
gagccaccccatctcagcatcaagcaggagcctcgggaagagccatgtgccctgggagcc
caggcggtgaagagggaggccaacggggagccaataggggcaccaggtaccagcaaccac
ctcctgctggcaggcccccgttcagaggccgggcatctgctcttgcagaagcttctacgg
gcaaagaatgtgcaactcagcactgggcgggggcccgaggggctgcgagctgagatcaac
gggcacattgacagcaagctggctgggctggagcagaaactacagggtacccccagcaac
aaggaggatacagcagcaaggaagcctgtgacaccgaagcccaagcgggtacagaaggca
agcgacaggttggtgagctcccgaaagaagctgcggaaggaggacggggtcagggccagc
gaggccttgctgaaacagctgaaacaggagctgtccctgctgcccctaacggagcctacc
atcaccgccaattttagcctctttgctcccttcggcagtggctgcccagtcaacgggcag
tgccagctgaggggggcctttggaagtggggcactgcccactggccctgactactattcc
cagctgcttaccaagaataacctgagtaacccgccgacaccaccctcgtcgctgcccccc
accccacccccatcggtgcagcagaagatggtgaatggcgtcactccatccgaagagctg
ggggagcaccccaaggatgctgcctctgcccgggatactgaagggacgctgagggatgct
tcagaggtgaagagtctagacctgctggccgccttgcctacaccccctcacaatcagact
gaggatgtcaggatggaaagtgacgaggacagcgattctcctgatagcattgtgccagct
tcgtcccccgaaagcatcctaggggaggaggcacctcgtttccctcagctgggctcaggc
cggtgggagcaggaagaccgggctctctcccctgttatccccataattcctcgggccagt
atcccagtcttcccagataccaaaccttatggggccctggacctggagacctctggaaag
ctgcctgccacaacttgggaaaagggcaaaggaagtgaggtgtcggtcatgctgacggtc
tctgctgctgcggccaagaacctgaatggtgtgatggtggcagtggcagagctgctaagc
atgaagatccccaactcctatgaggtgctgttcccagagagccctgcccgggcaggcatt
gagcctaagaagggggaagctgagggccctggagggaaagaaaagggtctgggaggcaag
agcccggaagctggccctgattggctgaaacagtttgatgcagtgttgcctggctatacc
ctcaagagccagctagacatcctgagcctcctgaaacaggagagccctgccccagagccc
cccacccaacacagctacacctacaacgtctccaatctggatgtgcgacagctctcggcc
ccacctcctgaggaaccctccccgcccccgtcccccttggcaccctctcctgccagcccc
cctgctgagcccctggttgaactcccggctgaaccctcagctgagccaccagtcccatcg
cctctgccactggcctcgtcccctgagtcagcccgacccaagcctcgagcccggccccct
gaagaaggtgaagattcccggccccctcgcctcaagaagtggaaaggggtgcgctggaag
cggctgcggctgctgctgaccatccagaagggcagtgggcggcaggaggacgagcgggaa
gtggcggagtttatggaacagctcggcacagccctgcgacccgacaaggtgcctcgtgat
atgcggcgctgctgcttctgtcatgaggagggtgacggggccactgatgggccggcgcgc
ctgctgaacctggacctggacctgtgggtgcacctcaactgtgccctgtggtccacagag
gtgtacgagacccagggtggggcgctgatgaacgttgaggtcgccctgcaccgagggctg
ctcaccaagtgctccctgtgccagcgcaccggcgccaccagcagctgcaatcgaatgcgt
tgccccaacgtctaccattttgcctgcgccatccgcgccaagtgcatgttcttcaaggac
aagaccatgctgtgtccaatgcataagatcaaggggccctgtgaacaggagctgagctct
tttgctgtcttccggcgggtctacattgagcgggatgaggtgaagcaaatcgccagcatc
atccagcggggagagcggctacacatgttccgcgtggggggccttgtgttccacgccatc
ggacagctgctccctcatcagatggctgacttccacagtgccactgccctctatcccgtt
ggctatgaggccacgcgcatctattggagcctccgcaccaacaaccgccgctgctgctac
cgctgctccatcggcgagaacaacggaaggccagagttcgtcatcaaagtcatggagcag
ggcctggaggacctggtcttcacggatgcctccccccaggctgtgtggaaccgcatcatc
gagcctgtggccgccatgagaaaagaggccgacatgctgcggctcttccccgagtacctg
aagggcgaggagctcttcgggctgacggtgcacgccgtgctgcgcatagctgaatcactg
cctggagtggagagctgtcaaaactatttattccgctacggacgccaccccctgatggag
ctgccactcatgatcaatcccactggttgtgcccgatcggagcctaaaatcctcacacac
tacaaacggcctcacaccctgaacagcaccagcatgtccaaggcatatcagagcaccttc
acaggcgagaccaacaccccatacagtaagcagtttgtgcactccaagtcatcacagtac
cggcgcctgcgcactgagtggaagaacaacgtgtacctggctcgctcccgtatccagggc
ctggggctctatgccgccaaggacctagaaaagcacacaatggtcatcgaatatattggc
accatcattcgcaatgaggtggccaaccggcgggagaaaatctatgaggagcagaatcgc
ggcatctacatgttccgaataaacaacgaacatgtaattgatgctacgttgaccggaggc
cctgccaggtacattaaccattcctgtgcccctaactgtgtggcggaagttgtgacattt
gacaaggaggataaaatcatcatcatctccagccggcgaatccccaaaggagaggagctg
acctatgactatcagtttgactttgaggacgatcagcacaagattccctgccactgtgga
gcctggaactgtcggaaatggatgaactaa

DBGET integrated database retrieval system