KEGG   Canis familiaris (dog): 486668Help
Entry
486668            CDS       T01007                                 

Gene name
ART4
Definition
ADP-ribosyltransferase 4 (Dombrock blood group)
Orthology
K06717  
ADP-ribosyltransferase 4 [EC:2.4.2.31]
Organism
cfa  Canis familiaris (dog)
Brite
Enzymes [BR:cfa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     486668 (ART4)
Cellular antigens [BR:cfa04090]
 Proteins
  486668 (ART4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
27
AA seq 328 aa AA seqDB search
MKLQEQRSAFNTNEYRPVPNRSRRILLPTPTAAPALRIWLLPRQLPLLMLFSALQTPTGS
SEVAVNIDFDLTPDSFDDQYQGCSPQVMEKLNQGDYFAKELKAHRNYSRIWANAHLTWLN
RAEDLPRSMNITHAVAILAYTSNNIVRTDFTRAMATAGRSPQQYKHSFHFKYLHYYLTSA
VQLLREEMILTNGSSCYEVHHEMKGNYLKANRGATIRFGQFLSTSLLQEEAQKVGNQTLL
TIFTCLGVPVQEFSLRKEVLVPPYEVFKVVNMSYHPQGNWLQLQSAGNLSTYNCQLLKGS
GKKYNPAPMVIACLSFLTSVVISSKSGV
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttcaagagcagagaagtgcttttaacacaaatgaataccgtccagtgcccaac
agaagcaggaggattcttctcccaactcctactgcagcccctgctctaaggatctggctt
cttcccaggcagcttcctctcttgatgctgttctcggccctgcagacacccaccgggagt
tctgaggttgcagttaacatcgactttgacttgacaccagattcctttgatgatcagtac
caaggctgcagcccacaggtcatggagaagctaaatcaaggggattattttgcaaaagaa
ctaaaagcacataggaattattctaggatctgggcaaacgcccacttaacctggttgaac
agagcagaagatctccccaggagcatgaatattacacatgctgtggccatcctggcttat
acatcaaacaacattgtccgcacagattttactagagccatggccactgctggcaggtcc
ccacagcagtataaacactcattccatttcaaatacctccactactacctgacttcagca
gtccagctgctaagggaagaaatgatcctgacgaatggctcttcatgttatgaggtacat
catgagatgaagggtaactatttgaaagccaacagaggggccaccatccgatttggccag
ttcctctccacttccctcctacaagaagaggcacagaaggttgggaaccaaactctactc
accatatttacctgcctgggagtgcctgtacaagaattctctctcaggaaggaagtcctg
gtccctccctatgaggtgttcaaagttgtaaatatgagctaccaccctcaaggaaattgg
ttgcaattgcagtcagctgggaacctgagcacatacaactgtcagctgctaaaaggttct
ggcaaaaagtacaatcctgctcctatggttattgcttgtctctcctttttgaccagtgtt
gtcatctcttccaaaagtggagtataa

DBGET integrated database retrieval system