KEGG   Canis familiaris (dog): 486718Help
Entry
486718            CDS       T01007                                 

Gene name
USP5
Definition
ubiquitin specific peptidase 5 (isopeptidase T)
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
cfa  Canis familiaris (dog)
Brite
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     486718 (USP5)
Peptidases [BR:cfa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   486718 (USP5)
Exosome [BR:cfa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   486718 (USP5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
27
AA seq 891 aa AA seqDB search
MRLTSSAHWTASLGGGGLGTVGAAVCGGAAAGVMAELSEEALLSVLPTIRVPKAGDRVHK
DECAFSFDTPESEGGLYICMNTFLGFGKQYVERHFNKTGQRVYLHLRRTRRPKEEDTTTG
TGDPPRKKPTRLAIGMEGGFDLSEEKFEYDEDVKIVILPDYLEIARDGLGGLPDLVRDRV
TSAVEALLSADSASRKQEVQAWDGEVRQVSKHAFNLKQLDNPARIPPCGWKCSKCDMREN
LWLNLTDGSILCGRRYFDGSGGNNHAVEHYRETGYPLAVKLGTITPDGADVYSYDEDDMV
LDPNLAEHLSHFGIDMLKMQKTDKTMTELEIDMNQRIGEWELIQESGVPLKPLFGPGYTG
IRNLGNSCYLNSVVQVLFSIPDFQRKYVDKLEKIFQNAPTDPTQDFSTQVAKLGHGLLSG
EYSKPAPESGDGEQVPEQKEVQDGIAPRMFKALIGKGHPEFSTNRQQDAQEFFLHLINMV
ERNCRSSENPNEVFRFLVEEKIKCLATEKVKYTQRVDYIMQLPVPMDAALNKEELLEYEE
KKRQAEEEKLPLPELVRAQVPFSSCLEAYGAPEQVDDFWSTALQAKSVAVKTTRFASFPD
YLVIQIKKFTFGLDWVPKKLDVSIEMPEELDISQLRGTGLQPGEEELPDIAPPLVTPDEP
KGSLGFYGNEDEDSFCSPHFSSPTSPMLDESVIIQLVEMGFPMDACRKAVYYTGNSGAEA
AMNWVMSHMDDPDFANPLILPGSSGPGSTSAAADPPPEDCVSTIVSMGFSRDQALKALRA
TNNSLERAVDWIFSHIDDLDAEAAMDISEGRSAADSISESVPVGPKVRDGPGKYQLFAFI
SHMGTSTMCGHYVCHIKKEGRWVIYNDQKVCASEKPPKDLGYIYFYQRVAS
NT seq 2676 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctaacgagtagtgctcattggacggcaagcctagggggtgggggactgggaacg
gtgggagccgctgtgtgtggaggagctgctgccggtgtcatggcggagctgagtgaggag
gcgctgctgtcagtattaccgacgatccgggttcctaaagcgggagaccgggtccacaaa
gacgagtgcgccttctccttcgacacaccggagtctgagggtggcctctacatctgcatg
aatacattcctgggctttgggaaacagtatgtggagagacatttcaacaagacgggccag
cgagtctacctgcacctccggaggacccggcgcccgaaagaggaggacaccactacaggc
actggagaccccccgcgtaagaagcccacccggctggctattggtatggaaggcgggttt
gacctcagtgaggagaagtttgaatatgatgaggatgtgaagattgtcattttgccggat
tacctggagattgcccgggatgggttggggggcctgcctgacctcgtcagagatcgggtg
accagtgcggtggaggccctactgtcggctgactcggcctcccgcaagcaggaggtacag
gcgtgggatggggaagtacggcaggtgtctaagcatgccttcaacctcaagcagctggac
aaccctgctcgaatccctccctgtggctggaagtgttccaagtgtgacatgagagagaac
ttgtggctcaacctgacagatggctccattctttgtggccgacgctacttcgatggcagt
ggtggcaacaaccatgccgtagagcactacagggagacaggctacccattagctgtcaag
ctgggcaccatcacacccgacggagctgatgtgtattcatatgatgaggatgacatggtc
ctggaccccaacctggctgagcacctgtcccactttggcatcgacatgctaaagatgcag
aagacggataagacgatgacggagttggagatagatatgaaccagcgcattggcgaatgg
gagctgatccaggagtcgggtgtgcctctgaagcccctatttgggcctggctacacgggc
atccggaacctgggtaacagctgctacctcaactctgtggtccaggtgctcttcagcatc
cctgacttccagaggaagtatgtggataaactggagaagatcttccagaatgccccaacg
gaccctacccaggacttcagcacccaggtggccaaactgggccatggccttctctcggga
gagtattccaagccggcgccagaatcaggcgatggggagcaggtgccagaacaaaaggaa
gttcaagatggcattgcccctcggatgttcaaggccctcattggcaagggtcaccctgag
ttctccaccaaccggcagcaggatgcccaagagttctttcttcaccttatcaacatggtg
gagaggaattgccggagctctgaaaatcctaatgaggtgttccgcttcttggtggaggaa
aagatcaagtgcctggccacagagaaggtgaagtacacccagcgagtggactacatcatg
cagttgcctgtgcccatggatgcggccctcaacaaagaggagcttctggagtatgaggaa
aagaagcggcaagctgaggaggagaagttgccactgccagaactggtccgggctcaggtg
cccttcagctcctgcctggaggcctatggggccccggagcaggtggacgacttctggagc
acagccctgcaggccaaatcagtagctgtcaagacgacacgatttgcctctttccctgac
tacctggtcatccagatcaagaagttcaccttcggcttagactgggtgcccaagaaactg
gatgtgtccattgagatgccagaggagctagacatctcccagttgaggggtacagggctg
cagcctggggaggaggagctgcctgacattgccccacccctggtcactccggatgagccc
aaaggtagccttggtttctatggcaacgaagacgaagactccttctgctcccctcacttc
tcctctccgacatcacccatgttggatgaatcagtcatcatccagctggtggagatgggc
ttcccgatggatgcctgccgtaaagctgtctactacacgggcaacagtggggctgaggct
gccatgaactgggtcatgtcacacatggacgatccagattttgcaaaccccctcatcctg
cctggctccagtgggcccggctccaccagtgcggcagctgaccccccaccagaagactgc
gtgagcaccatcgtttccatgggcttctcccgggaccaggccctgaaagcacttcgggcc
acgaacaatagtttagaaagggccgtggattggatcttcagtcacatcgatgacctggat
gcagaagccgccatggacatctcggagggccgctcggctgctgactccatctccgagtct
gtgccggtgggacctaaagtccgggatggccctggaaagtatcagctctttgccttcatc
agtcacatgggcacctctaccatgtgtggtcactatgtctgccacatcaagaaggaaggc
agatgggtgatctacaatgaccagaaagtgtgtgcctctgagaagccacccaaggacctg
ggctacatctacttctaccagagagtggccagctaa

DBGET integrated database retrieval system