KEGG   Canis familiaris (dog): 486839Help
Entry
486839            CDS       T01007                                 

Gene name
SCD
Definition
stearoyl-CoA desaturase (delta-9-desaturase)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
cfa  Canis familiaris (dog)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
PPAR signaling pathway
AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    486839 (SCD)
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    486839 (SCD)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    486839 (SCD)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    486839 (SCD)
Enzymes [BR:cfa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     486839 (SCD)
Lipid biosynthesis proteins [BR:cfa01004]
 Desaturase
  First
   486839 (SCD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
28
AA seq 360 aa AA seqDB search
MPAHLLQEEISSSYTTTTTITAPPSRILQNGGGKLEKPSLYLEEDIRPEIKDDIYDPTYK
DPEGRPKPKVEYVWRNIILMSLLHVGALYGITLIPTCKTYTWLWVFSYYLISAVGITAGA
HRLWSHRTYKARLPLRLFLIIANTMAFQNDVYEWARDHRAHHKFSETDADPHNSRRGFFF
SHVGWLLVRKHPAVKEKGGLLDLSDLKAEKLVMFQRRYYKPGILLMCFILPTFVPWYFWG
ETFLHSVCVATLLRYAIVLNATWLVNSAAHLYGYRPYDKNISPRENILVSLGAAGEGFHN
YHHSFPYDYSASEYRWHINFTTFFIDCMAALGLAYDRKKVSKAAILARIKRTGDGSYKSG
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgccggcccacttgctgcaggaggagatctctagctcctacacaaccaccaccaccatc
acagcgcctccctccaggatcctgcagaatggaggaggcaagttggagaagccttcccta
tacttggaagaagacatccgccctgaaatcaaagatgacatctacgacccaacctacaag
gatccggagggcagaccaaagcccaaggttgagtatgtctggagaaacatcatccttatg
tctctgctgcacgtgggagccctgtatgggatcacactgattcccacctgcaagacgtac
acctggctctgggtgttctcctactatctgatcagcgctgtgggcatcacagcaggggct
catcggctgtggagtcaccgcacctacaaagctcggctgcccctgaggcttttcctgatc
attgccaacacgatggcattccagaatgacgtgtatgaatgggcccgagatcaccgtgcc
caccacaagttttcagaaacagatgctgatcctcacaattcccggcgtggctttttcttc
tctcacgtgggttggctgcttgtacgcaaacacccagccgtcaaagagaagggtggtttg
ctagacttgtctgacctaaaagctgagaagctggtgatgttccagagaaggtactacaaa
cctggcatcctgttgatgtgcttcatcctgcccacctttgtgccctggtatttctggggt
gaaacttttctacacagtgtgtgcgttgctactctcctgcgttacgccattgtgctcaat
gccacatggctggtgaacagtgctgcccacctctacggatatcgcccttacgacaagaat
attagcccccgagagaatatcctggtttccctgggagctgcaggggagggcttccacaac
taccaccactcctttccctatgactactctgccagtgagtaccgctggcacatcaacttc
accaccttctttatcgattgcatggctgccctcggtctggcttacgaccggaagaaagta
tccaaggctgccatcttggccaggattaaaagaactggagacggaagctacaagagtggc
tga

DBGET integrated database retrieval system