KEGG   Canis familiaris (dog): 486839Help
Entry
486839            CDS       T01007                                 

Gene name
SCD
Definition
stearoyl-CoA desaturase (delta-9-desaturase)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
cfa  Canis familiaris (dog)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
PPAR signaling pathway
Class
Metabolism; Overview; Fatty acid metabolism [PATH:cfa01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:cfa01040]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:cfa03320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
28
AA seq 360 aa AA seqDB search
MPAHLLQEEISSSYTTTTTITAPPSRILQNGGGKLEKPSLYLEEDIRPEIKDDIYDPTYK
DPEGRPKPKVEYVWRNIILMSLLHVGALYGITLIPTCKTYTWLWVFSYYLISAVGITAGA
HRLWSHRTYKARLPLRLFLIIANTMAFQNDVYEWARDHRAHHKFSETDADPHNSRRGFFF
SHVGWLLVRKHPAVKEKGGLLDLSDLKAEKLVMFQRRYYKPGILLMCFILPTFVPWYFWG
ETFLHSVCVATLLRYAIVLNATWLVNSAAHLYGYRPYDKNISPRENILVSLGAAGEGFHN
YHHSFPYDYSASEYRWHINFTTFFIDCMAALGLAYDRKKVSKAAILARIKRTGDGSYKSG
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgccggcccacttgctgcaggaggagatctctagctcctacacaaccaccaccaccatc
acagcgcctccctccaggatcctgcagaatggaggaggcaagttggagaagccttcccta
tacttggaagaagacatccgccctgaaatcaaagatgacatctacgacccaacctacaag
gatccggagggcagaccaaagcccaaggttgagtatgtctggagaaacatcatccttatg
tctctgctgcacgtgggagccctgtatgggatcacactgattcccacctgcaagacgtac
acctggctctgggtgttctcctactatctgatcagcgctgtgggcatcacagcaggggct
catcggctgtggagtcaccgcacctacaaagctcggctgcccctgaggcttttcctgatc
attgccaacacgatggcattccagaatgacgtgtatgaatgggcccgagatcaccgtgcc
caccacaagttttcagaaacagatgctgatcctcacaattcccggcgtggctttttcttc
tctcacgtgggttggctgcttgtacgcaaacacccagccgtcaaagagaagggtggtttg
ctagacttgtctgacctaaaagctgagaagctggtgatgttccagagaaggtactacaaa
cctggcatcctgttgatgtgcttcatcctgcccacctttgtgccctggtatttctggggt
gaaacttttctacacagtgtgtgcgttgctactctcctgcgttacgccattgtgctcaat
gccacatggctggtgaacagtgctgcccacctctacggatatcgcccttacgacaagaat
attagcccccgagagaatatcctggtttccctgggagctgcaggggagggcttccacaac
taccaccactcctttccctatgactactctgccagtgagtaccgctggcacatcaacttc
accaccttctttatcgattgcatggctgccctcggtctggcttacgaccggaagaaagta
tccaaggctgccatcttggccaggattaaaagaactggagacggaagctacaagagtggc
tga

DBGET integrated database retrieval system