KEGG   Canis familiaris (dog): 486959Help
Entry
486959            CDS       T01007                                 

Gene name
MOS
Definition
v-mos Moloney murine sarcoma viral oncogene homolog
Orthology
K04367  
proto-oncogene serine/threonine-protein kinase mos [EC:2.7.11.1]
Organism
cfa  Canis familiaris (dog)
Pathway
MAPK signaling pathway
Oocyte meiosis
Regulation of actin cytoskeleton
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    486959 (MOS)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    486959 (MOS)
  Cell growth and death
   04114 Oocyte meiosis
    486959 (MOS)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    486959 (MOS)
Enzymes [BR:cfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     486959 (MOS)
Protein kinases [BR:cfa01001]
 Serine/threonine protein kinases: Other group
  MOS family
   486959 (MOS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
29
AA seq 372 aa AA seqDB search
MLPNSWDPLLLVYLSHFGVHFEGAMPSPLSRHSYLPSEFSPSVDSRPCSSPSELPSKAGK
LFLGGTPPRAPRLPRRLAWCSIDWEQVCFLQRLGAGGFGSVYKATYHGVLVAIKQVNKCT
KNRLASQRSFWAELNIARLRHDNIVQVVAASTRTPAGFNSLGTIIMEFGGNVTLHQVIYG
ATSCSEKDVQPHCCAGEQLNLGKCLQYSLDIVKGLLFLHSQNIVHLDLKPANILISEQDV
CKIGDFGCSEKLEDVLCFQTPPYPLGGTYTHRAPELLKGEMITPKADIYSFAITLWQMAT
KEAPYSGERQYVLYAVVAYNLRPSLSAAVFTDSISGKRLEKIIQCCWRASALQRPSAELL
LVDLNSLRAEFD
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgcttccaaactcgtgggaccctcttcttttggtttacctgagccactttggggtccac
tttgaaggtgccatgccctcacctctttcccggcacagttacctccccagtgagttttct
ccctcggtggactcgcggccctgcagcagcccttctgagctcccaagtaaagcagggaag
ctcttcctgggtggcactcctcccagggctccaaggctaccacgtcggctggcctggtgc
tccatcgactgggaacaggtgtgcttcctgcagaggctgggagctggcgggtttggctcc
gtgtacaaggcgacttaccatggtgttctggtggccataaaacaagtgaacaagtgcacc
aagaaccgactggcatcccagcgcagtttctgggctgagctcaacatcgcaaggcttcgc
catgataacatcgtgcaggtcgtggctgcaagcacacgcacacctgcgggatttaacagc
ctaggcaccataatcatggagtttggtggcaatgtcaccttacaccaagtcatatacggt
gccacaagctgctctgagaaggatgtgcagcctcactgctgtgccggagagcaattaaat
ctgggaaagtgtctgcagtattccctagatattgtgaaaggcctgcttttccttcactca
caaaacattgtacacttggacctgaagccggctaacattctgatcagtgagcaggatgtc
tgcaaaattggggacttcggttgctcagagaagctggaagacgtgctgtgcttccagact
cctccctaccccctggggggcacctacacccaccgagctccagagctcctgaaaggagag
atgataacgccaaaagctgacatctactcctttgccatcactctttggcaaatggctacc
aaggaggcgccctactcaggggagcggcagtacgtgctctacgctgtggtggcctataat
ctccgtccatctctgtcagcagctgtcttcactgactccatctctgggaaaagacttgag
aagatcatccagtgctgctggagggccagcgctctacagcggccaagtgcagaactcctc
ctggttgaccttaactctttaagagctgaatttgactga

DBGET integrated database retrieval system