KEGG   Canis familiaris (dog): 487083Help
Entry
487083            CDS       T01007                                 

Gene name
LYZL1, LYZL2
Definition
lysozyme-like 1
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
cfa  Canis familiaris (dog)
Brite
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     487083 (LYZL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2
AA seq 148 aa AA seqDB search
MKAAGILALIGCLIMVTEPKIYTRCKLAKIFLRAGLDNYQGFSLGNWICMAYYESRYNTT
AETQLEDGSIDYGIFQINSFTWCRRAKLQEKNHCHVACSALITDDLTDAILCAKKIAKET
EGMNYWQGWKKHCEGKDLSEWKKGCEVS
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgccggcatcttggccctgattggctgtctgatcatggtcactgagcccaaa
atctacactcgctgtaaactggcaaaaatatttttgagggctggcctggacaattaccag
ggttttagccttggaaactggatctgcatggcatactatgagagccgctacaatacaaca
gctgagacccagctggaggatggaagcattgactatggcatttttcagataaatagtttc
acgtggtgcagacgtgctaagctacaagagaagaaccactgtcacgttgcctgctcagcc
ttgatcacagatgatctcacagatgcaattctatgtgccaagaaaattgctaaagagaca
gaagggatgaactactggcaaggctggaagaaacactgtgagggcaaggacctgtctgag
tggaaaaagggatgtgaggtttcatga

DBGET integrated database retrieval system