KEGG   Canis familiaris (dog): 487107Help
Entry
487107            CDS       T01007                                 

Gene name
GAD2, GAD65
Definition
(RefSeq) glutamate decarboxylase 2 (pancreatic islets and brain, 65kDa) (EC:4.1.1.15)
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
cfa  Canis familiaris (dog)
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
GABAergic synapse
Type I diabetes mellitus
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    487107 (GAD2)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    487107 (GAD2)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    487107 (GAD2)
   00430 Taurine and hypotaurine metabolism
    487107 (GAD2)
 Environmental Information Processing
  Signal transduction
   02024 Quorum sensing system
    487107 (GAD2)
 Organismal Systems
  Nervous system
   04727 GABAergic synapse
    487107 (GAD2)
 Human Diseases
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    487107 (GAD2)
Enzymes [BR:cfa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     487107 (GAD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2
AA seq 585 aa AA seqDB search
MASPGSGFWSFGSEDGSGDPENPSTARAWCQVAQKFTGGIGNKLCALLYGDAEKPAESGG
SEPPRATSRKAACACNQKPCSCPKAEVNYAFLHATDLLPACDGERPTLAFLQDVMDILLQ
YVVKSFDRSTKVIDFHYPNELLQEYNWELADQPQNLEEILMHCQTTLKYAIKTGHPRYFN
QLSTGLDMVGLAADWLTSTANTNMFTYEIAPVFVLLEYVTLKKMREIIGWPGGSGDGIFS
PGGAISNMYAMLIARFKMFPEVKEKGMAAVPRLIAFTSEHSHFSLKKGAAALGIGTDSVI
LIKCDERGKMVPSDLERRILEAKQKGFVPFLVSATAGTTVYGAFDPLLAVADICKKYKIW
MHVDAAWGGGLLMSRKHKWKLSGVERANSVTWNPHKMMGVPLQCSALLVREEGLMQSCNQ
MHASYLFQQDKHYDLSYDTGDKALQCGRHVDVFKLWLMWRAKGTTGFEAHIDKCLELAEY
LYSIIKNREGYEMVFDGKPQHTNVCFWYVPPSLRVLEDNEERMNRLSKVAPVIKARMMEY
GTTMVSYQPLGDKVNFFRMVISNPAATHQDIDFLIEEIERLGQDL
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atggcatctccaggctctggcttctggtccttcgggtctgaagatggctccggggatccc
gagaaccccagcacagcgagagcctggtgtcaggtggcccagaagttcacgggcggcatc
ggaaacaagctgtgcgccctgctctacggagatgccgagaagcccgcggagagtggcggg
agcgagcccccgcgcgccacctccaggaaggccgcctgcgcttgtaatcagaagccttgc
agctgccccaaagcggaggtcaactatgcgtttctacacgcaacagacctgctgccagcc
tgtgatggagaaaggcccacgttggcgtttctgcaagatgttatggacattttgcttcag
tatgttgtgaaaagtttcgatagatcaaccaaagtgattgatttccattaccctaatgag
ctccttcaagagtataactgggaattggcagaccaaccacaaaatttggaggaaattttg
atgcattgccaaacgactctaaaatatgcaattaaaacagggcatcccagatatttcaat
cagctttccactggactggatatggttggattagcagcagactggctgacatcaacagca
aacacaaacatgttcacctatgaaattgctccagtatttgtgctcttggaatatgtcaca
ctaaagaaaatgagagaaatcattggctggccgggaggctctggcgatgggatattttct
cctggtggcgctatttctaacatgtatgccatgctgatcgcacgctttaagatgttccca
gaagtcaaggagaaaggaatggctgcggttcccaggctcattgccttcacatctgagcat
agtcacttttctctcaagaagggagctgcagctttggggattggaacagacagcgtgatt
ctgattaaatgtgatgagagggggaaaatggtcccatctgatcttgaaagaaggatcctt
gaagccaaacaaaaaggatttgttcctttccttgtgagcgccacagctgggaccaccgtg
tatggagcattcgaccccctcttagcagttgctgacatttgtaaaaagtacaagatctgg
atgcatgtggatgctgcttggggtgggggattactgatgtcccggaagcacaaatggaag
ctgagcggcgtggagagggccaactctgtgacatggaacccacacaagatgatgggcgtc
cctttacagtgctccgctctcctggttagagaagagggattgatgcagagttgcaaccag
atgcatgcctcctacctcttccagcaagataaacactatgacctgtcctatgatactggg
gataaggccttacagtgtggacgccacgttgatgtttttaaattatggctaatgtggagg
gcaaagggcaccactgggtttgaagcacatattgataagtgcctggagctggctgagtat
ttatacagtatcataaaaaaccgagaaggatacgaaatggtgtttgatggaaagcctcag
cacacaaatgtctgcttctggtacgtgcctccaagtttgcgtgtcctggaagacaatgaa
gagagaatgaaccgcctctcaaaggtggccccagtgattaaagcccgaatgatggagtat
gggaccacaatggtcagctatcagcccttgggagacaaggtcaatttcttccgcatggtt
atctcaaatcccgcagcaactcaccaagacatcgacttcctgattgaagaaatagaacgc
cttggacaagatttataa

DBGET integrated database retrieval system