KEGG   Canis familiaris (dog): 487107Help
Entry
487107            CDS       T01007                                 

Gene name
GAD2, GAD65
Definition
glutamate decarboxylase 2 (pancreatic islets and brain, 65kDa) (EC:4.1.1.15)
Orthology
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
cfa  Canis familiaris (dog)
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
GABAergic synapse
Type I diabetes mellitus
Module
GABA (gamma-Aminobutyrate) shunt
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:cfa00650]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:cfa00250]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:cfa00410]
Metabolism; Metabolism of other amino acids; Taurine and hypotaurine metabolism [PATH:cfa00430]
Organismal Systems; Nervous system; GABAergic synapse [PATH:cfa04727]
Human Diseases; Endocrine and metabolic diseases; Type I diabetes mellitus [PATH:cfa04940]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 585 aa AA seqDB search
MASPGSGFWSFGSEDGSGDPENPSTARAWCQVAQKFTGGIGNKLCALLYGDAEKPAESGG
SEPPRATSRKAACACNQKPCSCPKAEVNYAFLHATDLLPACDGERPTLAFLQDVMDILLQ
YVVKSFDRSTKVIDFHYPNELLQEYNWELADQPQNLEEILMHCQTTLKYAIKTGHPRYFN
QLSTGLDMVGLAADWLTSTANTNMFTYEIAPVFVLLEYVTLKKMREIIGWPGGSGDGIFS
PGGAISNMYAMLIARFKMFPEVKEKGMAAVPRLIAFTSEHSHFSLKKGAAALGIGTDSVI
LIKCDERGKMVPSDLERRILEAKQKGFVPFLVSATAGTTVYGAFDPLLAVADICKKYKIW
MHVDAAWGGGLLMSRKHKWKLSGVERANSVTWNPHKMMGVPLQCSALLVREEGLMQSCNQ
MHASYLFQQDKHYDLSYDTGDKALQCGRHVDVFKLWLMWRAKGTTGFEAHIDKCLELAEY
LYSIIKNREGYEMVFDGKPQHTNVCFWYVPPSLRVLEDNEERMNRLSKVAPVIKARMMEY
GTTMVSYQPLGDKVNFFRMVISNPAATHQDIDFLIEEIERLGQDL
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atggcatctccaggctctggcttctggtccttcgggtctgaagatggctccggggatccc
gagaaccccagcacagcgagagcctggtgtcaggtggcccagaagttcacgggcggcatc
ggaaacaagctgtgcgccctgctctacggagatgccgagaagcccgcggagagtggcggg
agcgagcccccgcgcgccacctccaggaaggccgcctgcgcttgtaatcagaagccttgc
agctgccccaaagcggaggtcaactatgcgtttctacacgcaacagacctgctgccagcc
tgtgatggagaaaggcccacgttggcgtttctgcaagatgttatggacattttgcttcag
tatgttgtgaaaagtttcgatagatcaaccaaagtgattgatttccattaccctaatgag
ctccttcaagagtataactgggaattggcagaccaaccacaaaatttggaggaaattttg
atgcattgccaaacgactctaaaatatgcaattaaaacagggcatcccagatatttcaat
cagctttccactggactggatatggttggattagcagcagactggctgacatcaacagca
aacacaaacatgttcacctatgaaattgctccagtatttgtgctcttggaatatgtcaca
ctaaagaaaatgagagaaatcattggctggccgggaggctctggcgatgggatattttct
cctggtggcgctatttctaacatgtatgccatgctgatcgcacgctttaagatgttccca
gaagtcaaggagaaaggaatggctgcggttcccaggctcattgccttcacatctgagcat
agtcacttttctctcaagaagggagctgcagctttggggattggaacagacagcgtgatt
ctgattaaatgtgatgagagggggaaaatggtcccatctgatcttgaaagaaggatcctt
gaagccaaacaaaaaggatttgttcctttccttgtgagcgccacagctgggaccaccgtg
tatggagcattcgaccccctcttagcagttgctgacatttgtaaaaagtacaagatctgg
atgcatgtggatgctgcttggggtgggggattactgatgtcccggaagcacaaatggaag
ctgagcggcgtggagagggccaactctgtgacatggaacccacacaagatgatgggcgtc
cctttacagtgctccgctctcctggttagagaagagggattgatgcagagttgcaaccag
atgcatgcctcctacctcttccagcaagataaacactatgacctgtcctatgatactggg
gataaggccttacagtgtggacgccacgttgatgtttttaaattatggctaatgtggagg
gcaaagggcaccactgggtttgaagcacatattgataagtgcctggagctggctgagtat
ttatacagtatcataaaaaaccgagaaggatacgaaatggtgtttgatggaaagcctcag
cacacaaatgtctgcttctggtacgtgcctccaagtttgcgtgtcctggaagacaatgaa
gagagaatgaaccgcctctcaaaggtggccccagtgattaaagcccgaatgatggagtat
gggaccacaatggtcagctatcagcccttgggagacaaggtcaatttcttccgcatggtt
atctcaaatcccgcagcaactcaccaagacatcgacttcctgattgaagaaatagaacgc
cttggacaagatttataa

DBGET integrated database retrieval system