KEGG   Canis familiaris (dog): 487119Help
Entry
487119            CDS       T01007                                 

Gene name
ITGA8
Definition
(RefSeq) integrin, alpha 8
  KO
K06584  
integrin alpha 8
Organism
cfa  Canis familiaris (dog)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Cell adhesion molecules (CAMs)
Regulation of actin cytoskeleton
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    487119 (ITGA8)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    487119 (ITGA8)
   04514 Cell adhesion molecules (CAMs)
    487119 (ITGA8)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    487119 (ITGA8)
  Cellular community
   04510 Focal adhesion
    487119 (ITGA8)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    487119 (ITGA8)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    487119 (ITGA8)
   05414 Dilated cardiomyopathy (DCM)
    487119 (ITGA8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 1146 aa AA seqDB search
MKEIQTGNGERVNEANRRDGNDITSEGQVKSTLPIAQAKNHGAVVIPPLLKFMSKYCWLY
LQNTSGRAGDVPLAQATPVLGSPRDSSILRRGGWSRLQRRRSTAVRAQPAVTERRGAGAV
GPGQPALSFASPPSPFWPPALHPLCKTIFSDARASVLVGAPKANTSQPDIVEGGAVYYCP
WPAQGSARCKQIPFDNTNNRKIRVNGTKEPIEFKSNQWFGATVKAHKGEVVACAPLYHWR
TLKPTPEKDPVGTCYVAIQNFSAYAEYSPCRNSNADPEGQGYCQAGFSLDFYKNGDLIVG
GPGSFYWQGQVITASIADIIANYSFKDILRKLAREKQTDVAPASYDDSYLGYSVAAGEFT
GDSEQELVAGVPRGAQNFGYVSIINSTDMTFIQNFTGEQMASYFGYTVTVSDVNNDGMDD
VLIGAPLFMEREFESSPREVGQVYLYLQENALVFRDPQILAGTEVFGRFGSAVAHLGDLN
QDGYNDIAIGAPFAGKDQRGQVLIYNGNKDGLNRKPSQILQGMWASQTIPSGFGFTLRGD
SDIDRNDYPDLIVGAFGTGKVAVYRARPVVTVDAQLLLHPMIINLENKTCQIPESLSSVA
CFSLSVCASVTGQSISNTIGLTAEVHLDSLKQKGAVKRTLFLDNHESHLIFPLTIKRQRS
LQCQDFVVYLRDETEFRDKLSPINISLNYSLDESTFKEGLEVKPILNYYRENTVTQQAHI
LVDCGEDNMCIPDLKLSARPDKHQVIIGDENHLTLIINARNEGEGAYEAELFVMIPEEAD
YVGIERSNKGLRPLSCEYEMENITRMVVCDLGNPMVAGTNYSLGLRFAVPRLEKTNMSIN
FDLQIRSSNKDNPDSNFVSLQINITAVAQVEIRGVSHPPQIVLPIHNWEPEEEPRKEEGI
GPLVEHIYELHNIGPSTISDTLLEVGWPFSARDEFLLYIFHVQTLGPLRCQTNPDINPQD
IKPATPPEDTPELSAFLRNSTIPHLVRRRDVGVLEPHRQSPAKILNCTNIECLQISCAVG
QLEGGESAVLKVRSRLWARTFLQRKNDPYTLASLVSFKVKKMPYKDQPAKLPEGSIAIKT
SVIWATPNVSFSIPLWVIILAILLGLLVLAILTLALWKCGFFDRARPPQDDMNDREQLTD
DKAAEA
NT seq 3441 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaaatccaaacaggaaatggagagagagtgaatgaggctaataggagagatggc
aacgacatcacctcagaaggtcaggtaaaatccactcttcccattgctcaggccaaaaac
catggtgctgtcgtcattcctccccttctcaagttcatgagcaaatactgttggctgtac
cttcaaaatacatccggaagagccggagacgtgccgcttgcacaggcaacgccagtcctg
gggagcccccgggactcgagcatcctgcgaaggggcggctggagccggttacagcgacgc
cgcagcacggctgttcgcgcacagcctgcggtaaccgagcgtcggggcgcgggcgccgtg
ggccccgggcagccggctctgtccttcgcttccccgccaagccccttctggcctcccgct
ttgcaccccctctgcaaaaccattttttcagacgcccgggccagcgtgttggtgggggcg
cccaaagccaacaccagccagcccgacatcgtggaagggggagccgtctactactgtccc
tggcccgcccaggggtctgcgcggtgcaagcagataccgtttgacaacaccaacaacaga
aaaatcagagttaatggaaccaaggaacctatagaatttaaatcaaatcagtggtttgga
gcaacagtgaaagctcacaaaggagaagttgtggcctgtgctcctttatatcactggagg
actcttaaaccaacaccagaaaaggacccagttggcacctgctatgtagcgatccagaac
ttcagtgcatatgcagaatattctccttgtcggaacagtaatgctgatccagaaggccag
ggttactgccaagcgggatttagtctggatttttataagaatggagacctcatagtagga
ggaccgggaagtttctattggcaaggtcaggtgatcactgccagtattgccgatatcatt
gcaaattactcattcaaggatattctaaggaaattggctcgagaaaagcagacagacgtg
gctccagcttcctatgatgacagttaccttggatattcagttgctgctggggaatttact
ggagactctgagcaagaactggttgctggcgttccaagaggagcacagaattttggatat
gtttcaatcattaactctacagatatgactttcattcagaatttcactggcgaacagatg
gcatcttattttggatatacggtcacagtgtcagatgttaacaatgatggaatggatgac
gtattgattggggcacctctctttatggaacgtgaatttgagagcagccctagggaagta
gggcaagtttacctgtatttgcaagagaacgcacttgtcttcagggacccacaaatcctg
gccggcactgaggtcttcgggagattcggtagtgccgtggctcacttaggagacctgaac
caagatggatacaatgacattgccatcggtgcacccttcgcaggcaaggatcaaagaggc
caagtactcatttacaatgggaacaaagatggcttaaacaggaagccttcccaaattcta
cagggaatgtgggcctctcagaccattccttcgggcttcggttttaccctaagaggagac
tcagacatagacaggaatgattacccagatttaatcgtaggtgcattcgggacaggaaaa
gtagctgtttacagggcaaggccagttgtcactgtagacgcccagcttttgctgcaccca
atgattatcaatctggaaaataaaacatgccagattccagagtctttgtcatctgtggcc
tgcttctctttaagcgtatgtgcatctgtaacaggccagagcatttcaaatacaataggc
ctgactgccgaggtgcacttggactccctgaaacaaaaaggagccgtgaaacgcacgctc
ttccttgacaaccatgagtcacatctcattttccccctcaccataaagcggcagagatcc
ctccaatgccaggattttgtcgtttaccttagagatgaaactgaattccgagataaatta
tctccaatcaacattagtttgaattacagtttggacgaatccacctttaaagaaggcctg
gaagtgaaaccaatattgaattactacagggaaaacactgttacccaacaggctcacatc
ctggtggactgtggagaagacaacatgtgcattcctgacttgaagctctcagctagacca
gataagcatcaggtcatcattggagatgaaaaccatcttacgctcataatcaatgcaaga
aatgaaggagaaggtgcctacgaagctgaactctttgtgatgataccagaagaggcagat
tatgttgggattgaacgcagcaacaaggggttgcgaccactgagttgtgagtacgagatg
gaaaatataaccaggatggtggtgtgtgaccttgggaaccctatggtggctggaacaaat
tattctctgggcctccgatttgcagttccacgtcttgagaaaacaaacatgagcattaac
ttcgatctccaaatcagaagttccaacaaggacaacccagacagcaattttgtgagcctg
caaatcaacatcactgctgtagctcaagtagaaataagaggagtatcccaccctccgcag
attgttttgcccattcataactgggagccagaagaggagccccgcaaagaggaaggaatt
ggtccactggtggaacatatttatgagctgcacaatattggaccaagtaccatcagcgac
acccttctggaagtgggctggccattctctgcccgggacgaatttctcctctacattttt
catgtccaaactctgggacctctacggtgtcaaacaaatcctgatattaacccacaggat
ataaagcccgccacccccccagaggacacccccgagctgagcgcctttttgcgaaactcg
accatccctcatcttgtccggaggagagatgtgggggtgctggagccccacagacagagc
cccgcaaaaatcctgaattgtacaaatatcgagtgcttacagatctcctgtgcagtgggg
cagctagaaggaggagaaagcgctgtcctaaaagtcagatcacggttatgggccaggacc
tttctccagagaaaaaatgatccctatactcttgcatccctggtgtccttcaaagttaag
aagatgccttataaagatcagccagcaaaactcccagagggaagcatagcaattaagaca
tcagttatttgggcaaccccaaatgtttccttttcaatcccattatgggtaataatacta
gcaatacttcttggattattggttctggccatcttaaccttagctttatggaagtgtgga
ttctttgacagagcaagacccccccaagatgatatgaatgacagggagcaactgacagat
gacaaagccgctgaggcatga

DBGET integrated database retrieval system