KEGG   Canis familiaris (dog): 487309Help
Entry
487309            CDS       T01007                                 

Gene name
HDAC1
Definition
histone deacetylase 1
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
cfa  Canis familiaris (dog)
Pathway
Cell cycle
Notch signaling pathway
Thyroid hormone signaling pathway
Huntington's disease
Alcoholism
Epstein-Barr virus infection
Pathways in cancer
Transcriptional misregulation in cancer
Viral carcinogenesis
Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    487309 (HDAC1)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    487309 (HDAC1)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    487309 (HDAC1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    487309 (HDAC1)
   05202 Transcriptional misregulation in cancers
    487309 (HDAC1)
   05203 Viral carcinogenesis
    487309 (HDAC1)
   05220 Chronic myeloid leukemia
    487309 (HDAC1)
  Neurodegenerative diseases
   05016 Huntington's disease
    487309 (HDAC1)
  Substance dependence
   05034 Alcoholism
    487309 (HDAC1)
  Infectious diseases
   05169 Epstein-Barr virus infection
    487309 (HDAC1)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     487309 (HDAC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 482 aa AA seqDB search
MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAN
AEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAS
AVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHG
DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAI
FKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGG
GGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLE
KIKQRLFENLRMLPHAPGVQMQVIPEDAIPEESGDEDEEDPDKRISICSSDKRIACEEEF
SDSDEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKQEAKGVKEEVK
LA
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagactcagggcaccaggaggaaagtctgttactactacgacggggatgttgga
aattactattatggacaaggccacccaatgaagcctcaccgaatccgtatgactcacaat
ttgctacttaactatggtctctaccgaaaaatggaaatctatcgccctcacaaagccaat
gccgaggagatgaccaagtaccacagtgatgactacattaaattcttgcgctccatccgc
ccagataacatgtccgagtacagtaagcagatgcagagattcaacgtcggtgaggactgt
ccagtatttgatggcctgtttgaattctgtcagttatctactggtggctctgtggcgagt
gctgtgaaattgaataagcagcagacagacatcgctgtgaattgggccggggggctgcac
catgcaaagaagtctgaggcatctggcttctgttacgtcaatgatatcgtcttggccatc
ctggaactgctaaagtatcaccagagggtgctgtatattgacattgatattcaccacggc
gatggcgtggaagaggccttctataccacagaccgggtcatgactgtgtcctttcataaa
tacggagagtacttcccaggaactggggacctacgggatattggggctggcaaaggcaag
tattatgctgttaactacccgctccgagatgggatcgatgacgagtcctatgaggccatt
ttcaagccggtcatgtccaaagtgatggagatgttccagcccagtgcggtggtcttacag
tgtggctctgactccctgtctggggatcggttaggttgcttcaatctcacgatcaaaggg
cacgccaagtgtgtggagtttgtgaagagcttcaacctgcctatgctgatgctgggagga
ggcggctacaccatccgtaatgtggcccgctgctggacatatgaaacagctgtggccctg
gacacggaaatcccgaatgagcttccgtacaatgactactttgaatactttggaccagat
ttcaaacttcacatcagtccttccaatatgaccaaccagaataccaatgaatacctggag
aagatcaaacagcgactgtttgagaacctgagaatgctgccccacgcacctggggtccaa
atgcaggtgattcctgaggatgccattccagaggagagtggcgacgaggacgaagaagac
cctgacaagcgcatctctatctgttcatctgacaaacgaattgcctgtgaggaagagttc
tcggactctgatgaggagggagaaggtggtcgtaagaactcttccaacttcaaaaaagcc
aagagagtcaaaactgaggacgaaaaagagaaagacccagaagagaagaaagaagtcaca
gaagaggagaaaaccaaggaggagaagcaagaagccaaaggggtcaaggaggaggtcaag
ttggcctga

DBGET integrated database retrieval system