KEGG   Canis familiaris (dog): 487414Help
Entry
487414            CDS       T01007                                 

Gene name
PADI2
Definition
peptidyl arginine deiminase, type II
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
cfa  Canis familiaris (dog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 723 aa AA seqDB search
MAYPSDSPPTSDELPPGFARMRAGARPEGSCPGAGSGPGGYSGSNFAQWGLLLVACPQAL
AKAATATTTHISQLRFTEDSTTPKRRSAVAAPAEAQTFSLKHSERVRVEVVRDGEAEEVA
TNGKQRWLLSPSTTLRVTMSQASTEASSDKVTVNYYDEEGSMPIDQAGLFLTAVEISLDV
DADRDGVVEKNNPKKASWTWGPEGQGAILLVNCDRDTPWLPKEDLNDEKVYSKEDLKDMS
QMILRTKGPDRLPAGYEIILYISMADSDKVGVFYVENPFFGQRYIHILGRRKLYHVVKYT
GGSAELLFFVEGLRFPDEGFPGLVSIHVSLLEYMAEEIPLTPIFTDTVIFRIAPWIMTPN
ILPPVSVFVCCMKDNYLFLKEVKNLVEKTNCELKVCFQYVNRGDRWIQDEVEFGYIEAPH
KGFPVVLDSPRDGNLKDFPVKQLLGPDFGYVTREPLFEPVTSLDSFGNLEVSPPVTVNGK
TYPLGRILIGSSFPLSGGRRMTKVVRDFLQAQQVQAPVELYSDWLTVGHVDEFMTFVPIP
GTKKFRMLMASTSACYKLFREKQREGHGEAIMFKGLGGMSSKRITINKILSNESLVQENQ
YFQRCLDWNRDILKKELGLTEQDIIDLPALFKMDEHRQARAFFPNMVNMIVLDKDLGIPK
PFGPQVEDVCCLETHVRSLLEPLGLCCTFVDDISAYHKFLGEVHCGTNVRRKPFSFKWWH
MVP
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atggcgtacccttctgactcaccacccacctcagatgagcttcctccaggatttgcccgg
atgcgggctggggccaggccagaggggagctgccctggggcgggatctggccctggggga
tactcaggctccaatttcgcccagtgggggctgctgctggtggcctgtccccaggctctg
gctaaagcggccactgccaccacgacccacatctcccagctgcgcttcactgaagactcc
accacccccaagagaaggagcgcagtcgcggccccagctgaggcccagaccttcagcctg
aagcactcggagcgggtgcgggtggaggtggtgcgcgatggggaggccgaggaggtggcc
accaacggcaaacagcgctggcttctgtcgcccagcaccacgctgcgggtcaccatgagc
caggccagcacggaggccagcagtgacaaggtcactgtcaactactacgacgaggaaggg
agtatgcccattgaccaggctgggctcttcctcacggccgttgagatctccctggatgtg
gatgcagaccgggatggtgtggtggagaagaacaaccccaaaaaggcatcctggacctgg
ggccccgagggccaaggggccatcctgctggtgaactgtgaccgagacacaccctggctg
cccaaggaggacctgaacgatgagaaggtctacagcaaggaagacctcaaggacatgtcc
cagatgatcctgcggaccaaaggcccggaccgcctccccgccggatacgagatcattctc
tacatttccatggccgactcggacaaagtgggcgtgttctatgtggaaaacccgtttttt
ggccagcgttacatccacatcctgggccggcggaagctctaccacgtggtcaagtacacg
ggcggctccgcggagctgctgttcttcgtggaaggcctgcgttttcccgacgagggcttc
ccaggcctggtctccatccacgtcagcctgctggagtacatggccgaggagattcctctg
actcccatcttcacggacaccgtgatattccggattgctccatggatcatgacccccaac
atcctgcctcctgtgtcggtgtttgtgtgctgcatgaaggacaattacttgttcctgaaa
gaggtgaagaacctggttgagaaaaccaactgtgaactgaaggtctgcttccagtacgta
aaccgaggtgaccgctggatccaggatgaagttgagtttggctacatagaggccccccac
aaaggcttccctgtggtactggactcaccccgagatggaaacctgaaggacttcccagtg
aagcagcttctgggcccagattttggctacgtgacccgggagcccctcttcgagcctgtc
accagccttgactcctttgggaacctggaggtcagtccaccagtgactgtgaacggcaag
acctaccccctaggccggatcctcatcgggagcagctttcctctgtccggcggtcggagg
atgaccaaggtggtgcgggacttcctgcaagcccagcaggtgcaggcgcccgtggagctc
tactcggactggctgaccgtgggccacgtggacgagttcatgaccttcgtccccatcccg
ggcacaaagaaattccggatgctcatggccagtacctcggcctgctacaagctcttccga
gagaagcagagggagggccacggggaagccatcatgttcaaaggcttgggcgggatgagc
agcaagcggatcaccatcaataagattctgtccaatgagagcctcgtgcaagagaaccag
tacttccagcgttgcctggactggaaccgtgacatcctcaagaaggagttggggctcacg
gagcaggacatcatcgatctccccgctctgttcaaaatggatgagcaccgccaggccagg
gccttcttcccaaacatggtgaacatgatcgtgctggacaaggacctgggcatccccaag
ccctttgggccccaggtggaggacgtgtgctgcctggagacgcacgtgcgctccctgctg
gagccgctgggcctctgctgcaccttcgtggacgacatctcggcctaccacaagttcctg
ggggaggtgcactgcggcaccaacgtgcgccggaagcccttctctttcaagtggtggcac
atggtgccctga

DBGET integrated database retrieval system