KEGG   Canis familiaris (dog): 487486Help
Entry
487486            CDS       T01007                                 

Gene name
THBS1
Definition
thrombospondin 1
Orthology
K16857  
thrombospondin 1
Organism
cfa  Canis familiaris (dog)
Pathway
Rap1 signaling pathway
p53 signaling pathway
Phagosome
PI3K-Akt signaling pathway
TGF-beta signaling pathway
Focal adhesion
ECM-receptor interaction
Malaria
Proteoglycans in cancer
MicroRNAs in cancer
Bladder cancer
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    487486 (THBS1)
   04350 TGF-beta signaling pathway
    487486 (THBS1)
   04151 PI3K-Akt signaling pathway
    487486 (THBS1)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    487486 (THBS1)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    487486 (THBS1)
  Cell growth and death
   04115 p53 signaling pathway
    487486 (THBS1)
  Cellular commiunity
   04510 Focal adhesion
    487486 (THBS1)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    487486 (THBS1)
   05205 Proteoglycans in cancer
    487486 (THBS1)
   05219 Bladder cancer
    487486 (THBS1)
  Infectious diseases
   05144 Malaria
    487486 (THBS1)
Heparan sulfate/heparin binding proteins [BR:cfa00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  487486 (THBS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
30
AA seq 1170 aa AA seqDB search
MGLAWALGVLFLLRVCASSRLPESGGDNSVFDIFELTGAARRGSGRRLVKGPDPSSPAFR
IEDANLIPPVPDDKFQDLVDAVRAEKGFLLLASLRQMKKTRGTLLAIERKDHSGQVFSVV
SNGRAGTLDLSLTVQGMQHVVSVEEALLATGQWKSITLFVQEDRAQLYIDCEKMENAELD
VPIQSIFTRDLASVARLRIAKGGVNDNFQGVLQNVRFVFGTTPEAILRNKGCSSSTNVLL
TLDNNVVNGSSPAIRTNYIGHKTKDLQAICGISCDELSSMVLELRGLRTIVTTLQDSIRK
VTEENKELAIELRRPPLCYHNGVQYRNNEEWTVDSCTECRCQNSVTICKKVSCPIMPCSN
ATVPDGECCPRCWPSDSADDGWSPWSEWTSCSATCGNGIQQRGRSCDSLNNRCEGSSVQT
RTCHIQECDKRFKQDGGWSHWSPWSSCSVTCGDGVITRIRLCNSPSPQMNGKPCEGEARE
TKACKKDACPINGGWGPWSLWDICSVTCGGGVQKRSRLCNNPTPQFGGKDCVGDATENQI
CNKQDCPIDGCLSNPCFAGVKCTSYRDGSWKCGTCPPGYSGNGIQCKDVDECKEVPDACF
NHNGEHRCENTDPGYNCLPCPPRFTGPQPFGRGVEHATAHKQVCKPRNPCTDGTHDCNKN
AKCSYLGHYSDPMYRCECKPGYAGNGIICGEDTDLDGWPNEDLVCVANATYHCKKDNCPN
LPNSGQEDYDKDGIGDACDDDDDNDKIPDDRDNCPFHYNPAQYDYDRDDVGDRCDNCPYN
HNPDQADTDNNGEGDACAADIDGDGILNERDNCQYVYNVDQRDTDMDGVGDQCDNCPLEH
NPDQLDSDSDRIGDTCDNNQDIDEDGHQNNLDNCPYVPNANQADHDKDGKGDACDHDDDN
DGIPDDRDNCRLVPNPDQKDSDGDGRGDACKDDFDHDNVPDIDDICPENIDISETDFRRF
QMIPLDPKGTSQNDPNWVVRHQGKELVQTVNCDPGLAVGYDEFNAVDFSGTFFINTERDD
DYAGFVFGYQSSSRFYVVMWKQVTQSYWDTNPTRAQGYSGLSVKVVNSTTGPGEHLRNAL
WHTGNTPGQVRTLWHDPRHIGWKDFTAYRWRLSHRPKTGFIRVVMYEGKKIMADSGPIYD
KTYAGGRLGLFVFSQEMVFFSDLKYECRDS
NT seq 3513 nt NT seq  +upstreamnt  +downstreamnt
atggggctggcctgggcactcggcgtcctgttcctgttgcgtgtgtgcgcctccagccgc
cttccagagtctgggggagacaacagcgtgttcgacatctttgaactcacgggggctgcc
cggaggggctctgggcgccggctggtgaagggtcctgacccctccagcccagctttccgc
atcgaggatgccaacctgatcccccccgtgcctgatgacaagttccaagacctagtggat
gctgtgcgcgcagagaaaggcttccttctcctggcctccctgaggcagatgaagaagacc
cgaggcacgctgctggccatagaacggaaagaccactctggccaggtcttcagcgtggtc
tccaacggcagagccggcaccctggacctgagcctgaccgtgcagggcatgcaacacgtg
gtgtcggtggaagaagcgctgctggccaccggccagtggaagagcatcaccctgttcgtg
caggaggacagggcccagctgtacattgactgtgagaagatggagaacgccgagctggat
gtccccatccagagcatcttcaccagggacctggccagcgtggccagactccgcatcgcg
aaaggaggggtcaacgacaacttccagggggtgctgcagaacgtgaggtttgtctttgga
accacaccagaagccattctcagaaacaaaggctgttccagttcgaccaacgtcctcctc
accctcgataacaatgtggtaaatggctccagccccgccatccgcactaactacatcggc
cacaagactaaggatctgcaagccatctgcggcatctcttgtgatgagctatccagcatg
gttctggagttgaggggcctgcgcaccattgtgaccacacttcaggacagcatccgcaaa
gtgactgaagagaacaaagaactggccattgagctgaggcggcctcccctctgctaccac
aatggagttcagtacaggaacaatgaggagtggaccgtcgatagttgtaccgagtgccgc
tgtcagaactccgttaccatctgcaagaaggtgtcctgccccatcatgccctgctccaac
gccacagttcctgacggagaatgctgcccacggtgttggcccagcgactctgcggatgat
ggctggtccccatggtccgagtggacctcctgctctgcgacatgtggcaatggaatccag
cagcgcgggcgctcctgtgatagtctcaacaaccgatgcgagggctcctccgtccagacg
cggacttgccacattcaggagtgcgacaagagatttaaacaggatggcggctggagccac
tggtccccgtggtcgtcttgttccgtgacgtgtggtgatggtgtgatcactagaattcga
ctctgcaattctcctagcccccagatgaacgggaaaccatgtgaaggcgaagcccgggag
accaaggcctgcaagaaagatgcctgccccatcaatggaggctggggtccctggtcactg
tgggacatctgttccgttacctgtggaggaggggtgcagaaacgtagccggctctgcaac
aaccccacaccccagtttggaggcaaggactgtgtcggtgatgcgaccgaaaaccagatt
tgcaacaagcaggactgtccaattgatggatgcctgtccaatccctgctttgctggggtc
aagtgtactagttaccgcgatggcagctggaaatgtggaacttgccccccgggctacagc
gggaatggcatccagtgcaaagacgtggatgagtgcaaagaagtccctgacgcctgcttc
aaccacaacggagagcacaggtgcgagaacacggaccccggctacaactgcctgccctgc
ccaccacgcttcacaggcccgcagcccttcggccgcggtgtagaacatgccaccgcccac
aaacaggtgtgtaagccccggaacccctgcacagatgggacacatgactgcaacaagaat
gccaagtgcagctacctgggccactacagcgaccctatgtatcgctgcgagtgtaagccc
ggctatgcgggcaacggcatcatctgtggggaggacacagacctggacggctggcccaat
gaggacctggtgtgcgtggccaatgccacctaccactgcaaaaaggataactgccccaac
cttcccaactctgggcaggaagactatgacaaggacgggattggcgacgcctgtgatgac
gacgatgacaatgataaaatcccagacgacagggacaactgtcctttccattacaaccca
gcccagtatgactatgacagagatgatgtcggagaccgctgtgacaactgcccctacaac
cacaacccagatcaggctgacacggacaacaacggggaaggagatgcctgcgccgcagac
atcgatggggacggtatcctcaatgaacgtgacaactgtcagtatgtctacaatgtggac
cagagggacactgatatggatggggttggagatcagtgtgacaactgccccctggaacat
aatccagatcagcttgactctgactcagaccgcattggagatacctgtgacaacaatcag
gatattgatgaagacggccaccaaaacaacctggacaactgtccctatgtgcccaatgcc
aaccaagctgaccatgacaaagatggcaagggagatgcctgtgaccatgatgatgacaat
gatggcattcctgatgacagggacaactgcagacttgtgcccaatcctgaccagaaggat
tccgatggtgatggtcgaggggatgcttgcaaagacgattttgaccatgacaatgtgcca
gacattgatgacatctgtcctgaaaacattgatatcagcgagactgatttccgcagattc
cagatgattcctctagatcccaaagggacatcccaaaatgaccctaactgggtggtacgt
catcagggtaaagaactcgtccagaccgtcaactgtgatcctggacttgctgtaggttat
gatgagttcaatgctgtggactttagtggcaccttcttcatcaacacagagagggatgat
gactatgctggatttgtgtttggctaccagtctagcagccgcttctatgtggtgatgtgg
aagcaagtcacacagtcctactgggacaccaaccccactcgggctcagggatactctggc
ctttccgtgaaagtcgtgaactctaccaccgggccaggcgagcacctgcggaatgccctg
tggcacacaggaaacacccctggccaggtgcgcactctgtggcatgaccctcgacacata
ggctggaaagatttcactgcctacagatggcgtctcagccaccggcccaagacgggtttc
attcgcgtggtgatgtatgaagggaagaaaatcatggctgattcaggacccatctatgac
aaaacttatgctggtggtaggctagggttgttcgtcttctctcaagaaatggtgttcttc
tctgacctgaaatacgaatgcagagattcctaa

DBGET integrated database retrieval system