KEGG   Canis familiaris (dog): 487532Help
Entry
487532            CDS       T01007                                 

Gene name
EIF3J, EIF3S1
Definition
eukaryotic translation initiation factor 3, subunit J
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
cfa  Canis familiaris (dog)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    487532 (EIF3J)
Translation factors [BR:cfa03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    487532 (EIF3J)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
30
AA seq 259 aa AA seqDB search
MAAAAAAAAGDSDSWDADTFSVEDPVRKVGGGGTAGGDRWEGEDEDEDVKDNWDDDDDEK
KEEAEVKPEVKVSEKKKIAEKIKEKERQQKKRQEEIKKRLEEPEEPKVLTPEELLADKLR
LKKLQEESDLELAKETFGVNNTVYGIDAMNPSSRDDFTEFGKLLKDKITQYEKSLYYASF
LEALVRDVCISLEIDDLKKITNSLTVLCSEKQKQEKQSKAKKKKKGVVPGGGLKATMKDD
LADYGGYDGGYVQDYEDFM
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggcggcggcggcggcgggggactctgattcctgggacgcggacacgttc
tccgtggaagacccggtgcggaaggtggggggcggcggcaccgccggcggggaccgctgg
gaaggcgaggacgaggacgaggacgtcaaggataactgggatgatgatgatgatgaaaaa
aaagaggaagcagaagtaaaaccagaagtaaaagtttcagaaaagaaaaaaatagcagag
aaaataaaagagaaagaacggcaacagaagaaaaggcaagaagaaattaaaaagaggtta
gaagaacctgaagaacctaaagtgctaacaccagaagaactattagcagataaactgagg
ctaaagaaattacaggaagagtcagaccttgaattagcaaaagaaacttttggtgttaat
aatacagtttatggaatagatgctatgaacccatcttcaagagatgacttcacagagttt
gggaagttactaaaagataaaattacacaatatgaaaagtcactatattatgctagtttt
ttggaagccttagttcgagatgtgtgtatttcattggaaattgatgacttgaaaaagatt
accaattcattgaccgtgctttgcagtgaaaaacaaaagcaagaaaagcaaagcaaagcc
aaaaagaagaagaaaggtgtggtccctggagggggattaaaggccaccatgaaagacgat
ctggcagattatggcggctatgacggcggatatgtacaagactatgaagacttcatgtga

DBGET integrated database retrieval system