KEGG   Canis familiaris (dog): 487564Help
Entry
487564            CDS       T01007                                 

Gene name
UNC13C
Definition
unc-13 homolog C (C. elegans)
Orthology
K15293  
protein unc-13
Organism
cfa  Canis familiaris (dog)
Pathway
Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Organismal Systems
  Nervous system
   04721 Synaptic vesicle cycle
    487564 (UNC13C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
30
AA seq 2217 aa AA seqDB search
MVANLFKSLILPYIHKLCKGMFTKKLGNTTKKKENRQQKKDQDFPTAGQTKTPKFSNTLK
STVKKIAKCSSTRNLSTEEEEANREFSLSPTFSYRVAIANGLQKNINLTNSDNEDLPQEL
SSIESSYTESLNELRSSAENQAQSTHTMPVRRNRKSSSSLAPSEGSSDGERTLHSLKLGA
LRKLRKWKKSQECVSSDSELSTMKKTWGIRSKSLDRTARNPKTNALEPGFSSSGCISQTH
DVMEMIFKELQGISQIETELCELRGHVNALKHSIDEISSSVEVVQSEIEQLRTGFVQSRR
ETRDIHDYIKHLGHMGSKASLRFLNVPEERFEYVESVVYQILIDKMGFLDAPNAIKIEFA
QRIGHQRDCPNAKPRPILVYFETPQQRDSVLKKSYKLKGTGIGISTDILTHDIRERKERG
IPSSQTYESMDIKLSTPEPRSKKNNWQSPDDSDGELESDLNRNSYAVLSKSEFPTKGSTS
KSCSKSHNARAKNKTASSSRISNKSDYDKISSRLPESDNLEKQTTTNYADATPLWHSQSD
FFTAKLSRSESDFSKLCQSYSEDFSENQFFSRTNGSSLLSSSDRELWQRKQEGTPTLYDS
LQDQHLNEVVQGVQGQSEIENTETVESGMSNGMVCASGDQSHYSDSQLSLHEDVSPWKDW
NQVEEKADLGLDSSTQEAFDYDTNSLSDTQLDVYNKDLEDLGKCHSDLQDDSESYDFTQD
DNSSPCPGLDNEPQGQWVGQYDSYQEANSNELYQNQNQLPIRYRSQSELQSDDSEDAPPK
SWHSRLSIDLSDKAFSFPKFGSTLQRAKSALEVVWNKSTQSLSGYEDSGSSLMGRFRTLS
QSTANESSTTLDSDVYTEPFYYKAEDEEDYSEPVADNETDYVEVMEQVLAKLENRTSLTE
TDEQMQVYDHPSYETPYETPQDEGYDGQGDDVVSEGGLEPLNETSAEMEIKEDENQNIPE
QPAEITKPKRIRPSFKEAALKAYKQQMAELEEKILAGDSSSVDEKARIVSGSDLDASKFS
GLQTIGGAGRGLYGIDSMPDLRRKKTLPIVRNVAMTLAARKSGLSLAMVIRTSLNNEELK
IHVFKKTLQALIYPMSSTTPHNFEVWTATTPTYCYECEGLLWGIARQGMKCLECGVKCHE
KCQDLLNADCLQRAAEKSSKHGAEDKTQTIITAMKERMKIREKNRPEVFEVIQEMFQISK
EDFVQYTKAAKQSVLDGTSKWSAKITITVVSAQGLQAKDKTGSSDPYVTVQVGKNKRRTK
TIFGNLNPVWDEKFYFECHNSTDRIKVRVWDEDDDIKSRVKQHFKKESDDFLGQTIVEVR
TLSGEMDVWYNLEKRTDKSAVSGAIRLKINVEIKGEEKVAPYHIQYTCLHENLFHYLTEV
KSNGGVKIPEVKGEEAWKVFFDDASQEIVDEFAMRYGIESIYQAMTHFSCLSSKYMCPGV
PAVMSTLLANINAFYAHTTVSTNVQVSASDRFAATNFGREKFIKLLDQLHNSLRIDLSKY
RENFPASNTERLQDLKSTVDLLTSITFFRMKVLELQSPPKASMVVKDCVRACLDSTYKYI
FDNCHELYSQLIDPSKKHDIPRDDQGPTTKNLDFWPQLITLMVTIIDEDKTAYTPVLNQF
PQELNMGKISAEIMWTLFAQDMKYALEEHEKQRLCKSTDYMNLHFKVKWFYNEYVRELPA
FKDAVPEYSLWFEPFVMQWLDENEDVSMEFLHGALGRDKKDGFQQTSDHALFSCSVVDVF
AQLNQSFEIIKKLECPNPEALSHLMRRFAKTINKVLLQYAAIVSSDFSSYCDKENVPCIL
MNNIQQLRVQLEKMFESMGGKELDPEASTILKELQVKLNGVLDELSITYGESFQLIIEEC
IKQMSFELNQMRTNGNIASNKNSAAMDAEIVLRPLMDFLDKTLSLSAKICEKTVLKRVLK
ELWKLVLNKIEKQIVLPPLTDQTGPQMIFIAAKDLGQLSKLKEHMIRDDAKGLTPRQCAV
MEVVLATIKQYFHAGGNGLKKNFLEKSPDLQSLRYALGLYTQTTDALIKKFIDTQTSQSR
PSKDSVGQISVHVDITAIPGTGEHKVTVKVIAINDLHWQTTAMFRPFVEVCILGPNLGDK
KRKQGTKTKSNTWSPKYNETFQFILGNENRPGAYELHLSVKDYCFAREDRIIGMTVIQLQ
NIADKGSYGAWYPLLKNVSMDETGLTILRILSQRTGDDVAKEFVRLKSETRSAEESA
NT seq 6654 nt NT seq  +upstreamnt  +downstreamnt
atggtggctaatcttttcaagagcctgatcttaccttacatacataagctttgcaaagga
atgtttacaaagaaattgggaaatacaaccaaaaaaaaggaaaatcgtcagcagaaaaag
gatcaagattttcctactgctggccagaccaaaacccccaaattttctaataccttaaaa
agcactgtaaagaagatagcaaagtgttcatctacacgcaacttatccactgaagaggaa
gaggctaatagagaattttccctctcaccaacattcagttaccgagtagctattgccaat
ggcctacaaaagaatattaatctaaccaacagtgataatgaggatctgcctcaagaatta
tcttcaattgagagttcctatacagaatcactcaatgaactaaggagtagtgcagaaaac
caggcacaatcaacacacacaatgccagttagacgcaatagaaagagttcaagcagcctg
gccccctctgagggcagctctgatggagaacgcactctacatagcttaaaactaggagca
ttacgaaaactgagaaaatggaaaaagagtcaggagtgtgtctcatcagattcagagttg
agcacaatgaagaaaacctggggaattagaagtaaatctttggacagaactgcacgaaac
ccaaagacaaatgctctggagccaggattcagttcctctggctgcattagccaaacacat
gatgtcatggaaatgatctttaaggaacttcagggtataagtcagattgaaacagaactt
tgtgaactacgaggacatgtcaatgctctcaagcattccatcgatgagatctccagcagt
gtggaggtcgtgcagagtgaaattgaacagttacgcacagggtttgtccagtctcggagg
gaaaccagagacatccatgattatattaaacatttaggtcatatgggtagcaaggcaagc
ctgagatttctaaatgtgcctgaagaaagatttgaatacgttgaaagtgtggtataccaa
attctaatagataaaatgggctttttggatgcaccaaatgctattaaaattgaatttgct
caaaggataggacaccagagggactgcccaaatgcaaagcctcgacccatacttgtgtac
tttgaaacccctcagcaacgggactctgtcttaaaaaaatcatacaaactcaaaggaaca
ggaattggaatctcaacagatattcttactcatgacataagagaaagaaaagagagaggg
ataccatcctcccagacatatgaaagcatggatataaagctgtctactccagagcccaga
agcaagaagaataactggcagtcaccggatgacagtgatggagagctggaatctgacctc
aatagaaacagttatgctgtgctttccaagtcagagtttccaacaaaaggaagtacttcc
aagtcatgttcaaaatcacacaatgctagagccaagaataaaactgctagtagcagcaga
atttcaaataaatctgattatgataaaatttcctcacgattgccagaatcagataatttg
gaaaaacaaactacaaccaattatgcagatgctacacccctctggcattcacagagtgat
tttttcactgctaaacttagtcgttctgaatcagatttttccaaactgtgtcagtcttac
tcagaggatttttcagaaaatcagtttttcagtagaactaatggaagctccctcctgtca
tcttcagaccgggaactttggcagaggaaacaggaaggaacacccaccttatatgacagt
ttgcaggatcaacatttgaatgaggttgttcagggtgtccaagggcagagtgaaattgag
aacacagaaactgtggagagtggaatgagtaatggcatggtgtgcgcatctggtgaccaa
agtcattacagtgattctcagctctctttacatgaggatgtttctccatggaaggattgg
aatcaagtagaagaaaaagctgacttaggtttagattcatccacccaggaagcttttgac
tatgacacaaacagcctatctgatacacaactagacgtttataataaagacctagaagac
ttgggaaagtgccacagtgaccttcaggatgactctgagagctatgatttcacccaagat
gacaactcatctccatgccctgggttggataatgaaccacaaggccagtgggttggccaa
tatgattcttatcaggaagctaattctaatgagctgtaccaaaatcaaaaccaattgccc
ataaggtaccgaagtcaaagtgaattgcaaagtgatgactcagaggatgccccacccaaa
tcttggcatagtcgattaagcattgacctttctgataaggctttcagcttcccaaaattt
ggatctacattacaaagggctaaatcagccttggaagtggtatggaacaaaagtacacag
agtctcagtggatatgaagacagtggctcttccttaatggggagatttcggacattatct
caatcaactgcaaatgaatcaagtaccacgcttgactctgatgtctacacagagcctttt
tattacaaagcagaggatgaggaggactatagtgaaccagtggctgataatgagacagat
tatgttgaagtgatggaacaagtcctcgctaaattagaaaacaggactagtctaactgaa
acagatgaacaaatgcaggtatatgatcacccttcatatgaaacaccctatgaaacccca
caagatgagggttatgatgggcagggagatgatgtggtcagtgaagggggattggaacca
ttaaatgaaacatcagctgaaatggaaataaaagaagatgaaaaccaaaacatccctgaa
cagccagcggaaattacaaagccaaagagaatccgtccctctttcaaagaagcagcttta
aaagcctataagcagcaaatggcagaattggaagagaagatcctggctggagatagcagt
tctgtggatgaaaaggctcgaatagtaagtggcagtgatttggatgcttccaaattctct
ggactccagacgattggtggggctggacgaggactttacggaattgacagtatgccagat
ctccgcaggaagaaaactttgcctattgtacgaaatgtggccatgactttggctgcccgg
aaatctggactctccctggctatggtgattaggacatcactaaacaatgaggaactgaaa
atacatgtcttcaagaagaccttacaggcactgatctaccccatgtcctccaccaccccc
cacaattttgaagtctggacggcaacaacacccacctactgttatgagtgtgaagggctc
ctgtggggcattgcccggcaaggcatgaagtgtttggagtgtggagtgaagtgccatgaa
aagtgtcaggatctcttaaatgctgactgtttgcagagagcagcagaaaagagttctaag
catggtgccgaagacaagactcagaccattattacagctatgaaagaaagaatgaagatt
agggagaaaaacaggccagaggtatttgaagtaattcaggaaatgtttcagatttctaaa
gaagattttgtgcagtacacaaaagcggccaagcagagtgtactagatgggacatctaag
tggtcagccaaaataaccattacagtggtttcagcacaaggtttacaagcaaaagacaaa
acagggtcaagtgacccatatgttactgttcaagtaggaaagaacaaaagaagaactaaa
accatttttggaaacttgaacccagtatgggatgagaagttttattttgaatgccacaac
tccacagatcgtatcaaagttagagtgtgggatgaagatgatgacattaaatccagagtc
aagcaacatttcaaaaaggagtcagatgattttttgggacaaacgattgtagaagtgagg
accctgagtggagagatggatgtctggtacaacctagagaaacggacagataagtcagct
gtgtctggagccattagattgaaaatcaatgtggaaataaaaggagaggagaaggttgcc
ccatatcatatacaatatacatgtttacatgagaatctgttccattacttgactgaagtg
aagtctaatggtggagtgaaaatcccagaggtcaaaggggaggaagcctggaaagttttc
tttgatgatgcttcccaagaaatagttgatgaatttgccatgcgttacgggattgaatcc
atttatcaagctatgacgcacttttcatgtctgtcttctaaatacatgtgccctggtgtc
cctgctgtcatgagcaccttgttggcgaatataaatgctttctatgctcacacaacagtt
tcaacgaatgtacaggtttctgcctcagatcgatttgccgctaccaactttggtagggaa
aaattcataaaactactggaccagttgcataactctttaaggattgacctgtcaaagtat
agggaaaactttcctgccagcaatactgaaagactgcaagacctgaaatcaactgttgac
ctgctaacaagtatcaccttttttaggatgaaggttctggagctgcaaagccccccaaag
gccagcatggtggtgaaggactgtgttagagcgtgcctggattctacatacaagtatatt
tttgacaattgtcatgaactctattcccagctgatagatccgagtaagaaacatgacatt
cctcgagacgatcagggaccaaccaccaagaatttggatttttggccccaacttattaca
ctgatggtcactattattgatgaggataaaactgcctacacacctgtcctgaatcaattt
cctcaagaactgaacatgggaaaaataagtgctgaaattatgtggaccctttttgctcaa
gatatgaaatatgcactggaagaacatgagaagcagcggttatgcaagagtaccgattat
atgaatttgcatttcaaagtgaaatggttttataatgaatatgtgcgagaacttcctgcc
ttcaaggatgctgttcctgaatactccctgtggtttgagccttttgtcatgcagtggctg
gatgaaaatgaagatgtatcaatggagttccttcatggagcactgggaagagacaaaaaa
gatggattccagcagacatctgatcatgccctcttctcttgttctgtggttgatgtcttt
gctcagcttaaccagagctttgagattattaagaaactagaatgccctaatcctgaagca
ttatctcacttaatgagaagatttgcaaagactatcaataaagtactgcttcagtatgct
gcgattgtatcgagtgacttcagttcatattgtgataaagaaaatgtgccctgtatattg
atgaacaatattcagcaattgcgggtccaactggaaaaaatgtttgaatccatgggagga
aaagagctagaccctgaagctagtactattctaaaagaacttcaagttaaactcaatggg
gttctggatgagctcagcatcacttatggtgaaagtttccagcttatcattgaagagtgt
ataaaacagatgagttttgaactaaaccaaatgagaacaaatggaaatattgcatctaat
aaaaacagtgcagcaatggatgcagagattgtactaagacctctcatggacttcttggac
aaaacattaagtctttcagcaaaaatctgtgagaaaacagttctgaagcgagttttgaag
gagttatggaagctagttcttaacaaaatagaaaaacaaattgttctccctcctctgaca
gatcaaacaggacctcagatgattttcatagcagctaaagatcttggacaattatccaaa
ttgaaggagcacatgattcgggacgatgccaagggtctaacaccaagacagtgtgctgta
atggaggtggtcctggctaccatcaagcaatactttcatgccggaggaaatggcctgaaa
aagaatttcttggagaaaagcccagatcttcagtctctgagatatgctcttggtctttat
acccaaactactgatgccttgataaagaaattcatagacactcagacctcacagagtcgc
ccctccaaagattcagtgggtcagatctccgttcatgtggacatcactgctatcccagga
actggagagcataaagtcactgtaaaagtgattgctatcaatgacctacactggcagacc
actgcaatgttccggccgtttgtggaagtttgtatactgggacccaaccttggagacaag
aagagaaaacaaggcacaaagacaaaaagcaacacatggtcaccaaagtacaatgaaaca
ttccagttcattctgggtaatgaaaaccggccaggggcctatgaacttcatctctcagtt
aaagattactgctttgccagagaagatagaattatcggaatgacagtaattcaactacag
aacatagcagacaagggaagctatggagcatggtatccccttctgaaaaatgtctctatg
gatgaaactggcttgacgatccttagaatactctctcagaggaccggcgatgacgtggct
aaagaattcgtaagactgaaatctgagacgagatctgccgaagagagcgcttga

DBGET integrated database retrieval system