KEGG   Canis familiaris (dog): 487590Help
Entry
487590            CDS       T01007                                 

Gene name
USP3
Definition
ubiquitin specific peptidase 3
Orthology
K11986  
ubiquitin carboxyl-terminal hydrolase 3 [EC:3.1.2.15]
Organism
cfa  Canis familiaris (dog)
Brite
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     487590 (USP3)
Peptidases [BR:cfa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   487590 (USP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
30
AA seq 535 aa AA seqDB search
MECPHLSSSVCIAPDSAKFPNGSPSSWCCSVCRSNKSPWVCLTCSSVHCGRYVNGHAKKH
YEDAQVPLTNHKKSEKQDKPQHTVCMDCSSYSTYCYRCDDFVVNDTKLGLVQKVREHLQN
LENSAFTADRHRKRKLLENSSLNSKLLKVNGSTAAICATGLRNLGNTCFMNAILQSLSNI
EQFCCYFKELPAVELRNGKTAGRRTYHTRSQGDNNVSLVEEFRKTLCALWQGSQTAFSPE
SLFYVVWKIMPNFRGYQQQDAHEFMRYLLDHLHLELQGGFNGVSRSAILQENSTLSASNK
CCMKGIYKTNSPKTERKANGASTVVTAIFGGILQNEVNCLICGTESRKFDPFLDLSLDIP
SQFRNKRSKNQENGPVCSLRDCLRSFTDLEELDETELYMCHKCKKKQKSTKKFWIQKLPK
VLCLHLKRFHWTAYLRNKVDTYVEFPLRGLDMKCYLLEPENSGPEHCLYDLAAVVVHHGS
GVGSGHYTAYATHEGRWFHFNDSTVTLTDEDTVVKAKAYILFYVERQAKAGSDKL
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atggagtgtccgcacctcagctccagcgtctgcatcgctccggactcagccaagttcccc
aacggctccccgtcgtcctggtgttgcagcgtgtgccgatccaacaaaagcccctgggtc
tgtttgacttgttcaagtgtccactgtggaaggtatgtgaatggccatgcaaaaaaacat
tatgaagatgcacaagtacccttaactaatcataagaaatcagaaaagcaagataaacct
cagcacacagtgtgtatggattgcagtagctacagtacatactgttatcgctgtgatgat
tttgtggttaatgacaccaagctgggactggtacagaaagtcagagaacacttacagaac
ttggaaaactcagctttcacagctgacaggcataggaaaagaaaactcttggaaaactca
tcactaaacagcaagttattaaaagtaaatggaagcactgctgccatctgtgccacaggc
ctccggaatctgggaaacacctgtttcatgaatgccatcctccagtcactcagtaacatt
gagcagttttgctgttatttcaaagaactgcccgctgtggagttaaggaatgggaaaaca
gcaggaaggcgaacataccacaccaggagccaaggggataacaatgtgtctttggtggaa
gagtttagaaagacactctgtgctttatggcaaggtagccagactgcatttagcccagag
tccttattttatgtcgtttggaagattatgccaaattttaggggctatcagcaacaggat
gcccacgaattcatgcgctaccttttggaccacctgcacttggaactccagggtggcttc
aatggtgtttcccgctcagcaattctgcaggagaattctactctatctgcaagtaacaaa
tgttgcatgaaagggatttacaagacaaactccccaaagacagaaagaaaagcaaatgga
gcatctacagttgtcacggctatattcggaggtattctccaaaatgaagttaactgcctc
atatgtgggacggaatctagaaagtttgatccattcctagatctttcattagatattcca
agtcagttcagaaataagcgctctaagaatcaagaaaatggaccagtttgttcattacga
gattgtcttcgcagttttaccgacttagaagaacttgatgagacagagttatatatgtgc
cacaaatgcaaaaagaaacaaaagtccactaaaaagttttggattcagaaactacccaag
gtgctatgcttacatttgaaacggtttcattggactgcatatttaagaaacaaagttgat
acctatgtagaatttcccctgagaggcctggacatgaaatgctacttgctagagcctgag
aacagtggcccagagcactgcctgtacgaccttgctgctgtggtggtgcaccatggttcc
ggggttggttctggacattacacagcatatgcaactcacgaaggtcgctggttccatttc
aatgacagtactgtgacactgactgatgaggacaccgtcgtgaaagcaaaggcctacatc
cttttctatgtggaacgccaggccaaagctggatcagataaactttaa

DBGET integrated database retrieval system