KEGG   Canis familiaris (dog): 487755Help
Entry
487755            CDS       T01007                                 

Gene name
DYRK1A
Definition
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A
Orthology
K08825  
dual specificity tyrosine-phosphorylation-regulated kinase 1 [EC:2.7.12.1]
Organism
cfa  Canis familiaris (dog)
Brite
Enzymes [BR:cfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     487755 (DYRK1A)
Protein kinases [BR:cfa01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   487755 (DYRK1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
31
AA seq 763 aa AA seqDB search
MHTGGETSACKPSSVRLAPSFSFHAAGLQMAGQMPHSHQYSDRRQPNINDQQVSALSYSD
QIQQPLTNQVMPDIVMLQRRMPQTFRDPATAPLRKLSVDLIKTYKHINEVYYAKKKRRHQ
QGQGDDSSHKKERKVYNDGYDDDNYDYIVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRV
EQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDTEMKYYIVHLKRHFMFRNHLCLVFEM
LSYNLYDLLRNTNFRGVSLNLTRKFAQQMCTALLFLATPELSIIHCDLKPENILLCNPKR
SAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPL
FSGANEVDQMNKIVEVLSIPPAHILDQAPKARKFFEKLPDGTWNLKKTKDGKREYKPPGT
RKLHNILGVETGGPGGRRAGESGHTVADYLKFKDLILRMLDYDPKTRIQPYYALQHSFFK
KTADEGTNTSNSVSTSPAMEQSQSSGTTSSTSSSSGGSSGTSNSGRARSDPTHQHRHSGG
HFTAAVQAMDCETHSPQVRQQFPAPLGWSGTEAPTQVTVETHPVQETTFHVAPQQNALHH
HHGNSSHHHHHHHHHHHHHGQQALGNRTRPRVYNSPTNSSSTQDSMEXGHSHHSMTSLSS
STTSSSTSSSSTGNQGNQAYQNRPVAANTLDFGQNGAMDVNLTVYSNPRQETGIAGHPTY
QFSANTGPTHYMTEGHLTMRQGADREESPMTGVCVQQSSVASS
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
atgcatacaggaggagagacttcagcatgcaaaccttcatctgttcggcttgcaccgtca
ttttcattccatgctgctggccttcagatggctggacagatgccccattcacatcagtac
agtgaccgtcgccagccaaacataaatgaccaacaggtttctgccttatcttattctgac
cagattcagcaacctctaactaaccaggtgatgcctgatattgtcatgttacagaggcgg
atgccccaaaccttccgtgatccagcaactgctcccctgagaaaactttctgttgacttg
atcaaaacatataagcatattaatgaggtttactatgcaaaaaagaagcgaagacaccaa
cagggccagggagacgattctagtcataagaaggagcggaaggtttacaatgatggttat
gatgatgataactatgattatattgtaaaaaacggagagaagtggatggatcgttacgaa
attgactccttgattggcaaaggttcctttggacaggttgtaaaggcatatgatcgtgtg
gagcaagaatgggttgccattaaaataataaagaacaagaaggcttttctgaatcaagcc
cagatagaagtgcgacttcttgagctcatgaacaaacatgacactgaaatgaaatactac
atagtgcatttgaaacgccactttatgtttcgaaaccatctctgtttagtttttgaaatg
ctgtcctacaacctctatgacttgttgaggaacaccaattttcgaggtgtctctttgaac
ctaacacgaaagtttgcacagcagatgtgcactgcactgcttttcctcgcgactccagaa
cttagtatcattcactgtgacttaaaacctgagaatatccttctttgtaaccccaaacgc
agtgcaatcaagatcgttgactttggcagttcttgtcagttggggcagaggatataccag
tacattcagagtcgcttttaccggtctccagaggtgctgctgggaatgccttacgacctt
gctatcgatatgtggtcccttgggtgtattttggttgaaatgcacactggagaacctctg
ttcagtggagccaatgaggtagatcagatgaataaaatagtggaagttctgagtatccca
cctgctcatattcttgaccaagcaccaaaagcaagaaagttctttgagaagttgccagat
ggcacttggaacttaaagaagaccaaagatggaaaacgggagtataaaccaccaggaacc
cgtaaacttcataatattctcggagtagaaacaggaggacctggtgggcgtcgtgctggg
gaatcgggtcatactgtagctgactacttgaagttcaaagacctcattttaaggatgctt
gattatgaccccaaaactcgaattcaaccttactatgccctgcagcacagttttttcaag
aaaacagctgacgaaggcaccaatacaagtaatagtgtgtccaccagccccgcgatggag
cagtcacagtcctcgggcaccacctcgagtacatcttcaagctcaggtggatcgtcgggg
acgagcaacagcgggagagccaggtcggatccaacgcaccaacatcggcacagcggcggg
cacttcacagctgccgtccaggccatggactgtgagacccacagcccccaggtgcgtcag
caatttcctgctcccctcggttggtcaggcacggaagctcctacacaggtcactgttgaa
actcatcctgttcaagaaaccacctttcatgtagcccctcaacagaatgcattgcatcat
caccatggaaacagttcccatcaccatcaccaccaccaccaccaccaccaccaccatgga
caacaagccttgggtaaccggaccaggccaagggtctacaattctccaacgaatagctcc
tctacccaggattctatggagnttggccatagtcaccactccatgacatccctgtcttcc
tcaactacttcttcctctacatcttcctcctctactggtaatcaaggcaatcaagcctac
cagaatcgcccagtggctgctaataccttggactttggacagaatggagctatggacgtt
aatttaaccgtctactccaatccccgccaagagactggcatagctggacatccaacatac
caattttctgctaatacaggtcctacacattacatgactgaaggacatctgacaatgagg
caaggggctgatagagaagagtcccccatgacaggagtttgtgtgcaacagagttctgta
gctagctcgtga

DBGET integrated database retrieval system