KEGG   Canis familiaris (dog): 487797Help
Entry
487797            CDS       T01007                                 

Gene name
PFKL
Definition
phosphofructokinase, liver
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cfa  Canis familiaris (dog)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
AMPK signaling pathway
Central carbon metabolism in cancer
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    487797 (PFKL)
   01230 Biosynthesis of amino acids
    487797 (PFKL)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    487797 (PFKL)
   00030 Pentose phosphate pathway
    487797 (PFKL)
   00051 Fructose and mannose metabolism
    487797 (PFKL)
   00052 Galactose metabolism
    487797 (PFKL)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    487797 (PFKL)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    487797 (PFKL)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    487797 (PFKL)
Enzymes [BR:cfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     487797 (PFKL)
Protein phosphatases and associated proteins [BR:cfa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     487797 (PFKL)
Messenger RNA biogenesis [BR:cfa03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     487797 (PFKL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
31
AA seq 780 aa AA seqDB search
MATVDLEKLRMSGAGKAIGVLTSGGDAQGMNAAVRAVTRMGIYVGAKVFLIYEGYEGLVE
GGENIKQANWLSVSNIIQLGGTVIGSARCKAFTTREGRLAAAYNLVQRGITNLCVIGGDG
SLTGADIFRSEWGSLLEELVAAGRISESTAQTYSHLSIVGLVGSIDNDFCGTDMTIGTDS
ALHRIMEVIDAITTTAQSHQRTFVLEVMGRHCGYLALVSALASGADWLFIPEAPPEDGWE
NFMCERLGETRSRGSRLNIIIIAEGAIDRNGKPISSRYVKDLVVQRLGFDTRVTVLGHVQ
RGGTPSAFDRILSSKMGMEAVMALLEATADTQACVVSLSGNQSVRLPLMECVQVTKEVQK
AMDEKRFDEAIQLRGRSFENNWNIYKLLAHQKVSKEKTNFSLAILNVGAPAAGMNAAVRS
AVRSGISQGHTVYVVHDGFEGLAKGQVQEVSWHDVAGWLGRGGSMLGTKRTLPRSYMEKI
VDNIRTYNIHALLVIGGFEAYEGVLQLVEARGRYEELCIVMCVIPATISNNVPGTDFSLG
SDTAVNAAMESCDRIKQSASGTKRRVFIVETMGGYCGYLATVTGIAVGADAAYVFEDPFN
IQDLKANVEHMTEKMKTDIQRGLVLRNEKCHEHYTTEFLYNLYSSEGKGVFDCRTNVLGH
LQQGGAPTPFDRNYGTKLGVKAMLWMSEKLRAVYRNGRVFANAPDSACVIGLQKKAVAFS
PVTELKEVTDFEHRMPREQWWLNLRLMLKMLAHYRISMADYVSGELEHVTRRSLSIDKGF
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atggccacggtggacctggagaagctgcggatgtccggggccggcaaggccatcggcgtg
ctgaccagcggcggcgacgcgcaaggaatgaacgcggccgtcagagctgtgacgcgcatg
ggcatttacgtgggagccaaggtcttcctcatctacgagggctatgagggtctcgtggaa
ggaggtgagaacatcaagcaggccaactggctcagcgtctccaacatcatccagctgggc
ggcaccgtcatcggcagcgcgcgctgtaaggccttcaccacccgggagggacgcctggcg
gcggcctacaacctggtgcagcgcggcatcaccaacctgtgcgtcatcggcggggacggc
agcctgacgggcgccgacatcttccgcagcgagtggggcagcctgctggaggagctggtg
gcggcaggcaggatctcggagagcacggcgcagacctactcgcacctgagcatcgtgggg
ctggtgggctccatcgacaacgacttctgcggcaccgacatgaccatcggcacggactcg
gccctgcaccgcatcatggaggtcatcgacgccatcaccaccaccgcccagagccaccag
aggaccttcgtgctggaggtgatgggacggcactgcgggtacctggccctggtgtccgcc
ctggcctcgggggccgactggctcttcatccccgaggcgccccccgaggacggctgggag
aacttcatgtgcgagaggctcggagagactcggagcagggggtcccgactgaacatcatc
atcatcgcggagggcgccatcgaccgcaacgggaagcccatctcgtcccgctacgtgaag
gacctggtggtccagaggctgggcttcgacacgcgtgtgaccgtgctgggccacgtgcag
aggggagggaccccttcggcatttgaccgcatcctgagcagcaagatgggcatggaggcc
gtcatggcgctgctggaggccacagcggacacgcaggcctgcgtggtcagcctctcgggg
aaccagtccgtgcggctgcccctcatggagtgtgtgcaggtgaccaaggaggtgcagaag
gccatggacgagaagcggttcgacgaggccatccagctccgcggcaggagctttgagaac
aactggaacatttacaagctgcttgcacaccagaaggtctccaaggagaagaccaacttc
tccttggccatcctgaacgtgggggccccggcggctggcatgaacgcggccgtgcgctcg
gcggtgcggtcgggcatctcccagggccacacggtgtacgtcgtacacgacggcttcgag
ggtctggccaagggtcaggtacaagaggtgagttggcacgacgtggccggctggctgggc
cgtggcggctccatgctggggacgaagaggacgctgcccaggagctacatggagaagata
gtggacaacattcgcacctacaacatccacgccctgctggtcatcgggggctttgaggcc
tacgagggggtgctgcagctggtggaggcgcgcggccgctacgaggagctctgcatcgtc
atgtgcgtcatcccggccaccatcagcaacaacgtgccgggcaccgacttcagtctgggc
tcagacaccgccgtcaacgccgccatggagagctgtgaccgcatcaagcagtcggcgtcg
ggcaccaagcgccgcgtgttcatcgtggagaccatgggcggctactgtggctacctggcc
acggtgactggcattgctgtgggggccgacgccgcctacgtcttcgaggaccctttcaac
atccaagacctgaaagccaacgtggagcacatgaccgagaagatgaagacagacatccag
aggggcctcgtgctccgaaacgagaagtgccacgagcactacaccacggagtttctgtat
aacctgtactcctccgaggggaagggcgtctttgactgtaggaccaacgttctgggccac
ctgcagcagggtggggctccgaccccctttgaccggaactacggcacgaagctgggggtg
aaggcgatgctctggatgtcagagaagctgcgggccgtctaccgcaacggccgcgtgttc
gccaacgcccccgattcggcctgcgtgatcggcctgcagaagaaggcggtggccttcagc
cccgtcaccgagctcaaggaggtcacggactttgagcaccgcatgccccgggagcagtgg
tggctgaacctgcggctcatgctgaagatgctggcgcactaccgcatcagcatggccgac
tacgtgtccggggagctggagcacgtcacccgccgcagcctcagcatcgacaagggcttc
tga

DBGET integrated database retrieval system