KEGG   Canis familiaris (dog): 487831Help
Entry
487831            CDS       T01007                                 

Gene name
SCD5
Definition
stearoyl-CoA desaturase 5
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
cfa  Canis familiaris (dog)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
PPAR signaling pathway
AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    487831 (SCD5)
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    487831 (SCD5)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    487831 (SCD5)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    487831 (SCD5)
Enzymes [BR:cfa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     487831 (SCD5)
Lipid biosynthesis proteins [BR:cfa01004]
 Desaturase
  First
   487831 (SCD5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
32
AA seq 322 aa AA seqDB search
MPGPAADGGQVPFRGAKEEIRPRVEGPGDGGGPRHGVVWRNVVLMSLLHLAAVYSLALIP
AAQPLTLLWAYFCFLLTALGVTAGAHRLWSHRSYKAKLPLRIFLAAANSMAFQNDIFEWA
RDHRVHHKYSETDADPHNARRGFFFSHIGWLFVRKHRDVIEKGRKLDVTDLLADPVVRFQ
RKYYKITVVLMCFVIPTLVPWCVWGESLWNSYFLASILRYTISLNITWLVNSAAHMYGNR
PYDKHISPRQNPLVTLGAIGEGFHNYHHTFPFDYSASEFGLNFNPTTWFIDLMCWLGLAT
DRKRATKPMIEARKARTGDGST
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgccgggcccggccgccgacggggggcaggtccccttccgcggcgccaaggaggagatc
cggccgagggtcgaaggccccggggacggcggcggcccgcggcacggcgtcgtctggagg
aacgtggtcctgatgagcctgctccacttggcggccgtgtactccctggcgctgatcccc
gcggcccagccgctcaccctgctctgggcctacttctgcttcctcctgactgctctgggt
gtcacagctggtgcccatcgcctgtggagccacagatcctacaaggccaagctgcctctg
aggatattcctggctgctgccaactccatggctttccagaatgacattttcgagtgggcc
agggaccaccgagtccaccacaagtactcagagactgacgctgaccctcacaatgcccgc
cggggcttcttcttctcccatatcgggtggctgtttgttcgcaaacatcgagatgtcatc
gagaaggggagaaagcttgacgtcactgacctgctggctgatcctgtggtccgattccag
agaaagtactataagatcaccgtggtgctcatgtgctttgtgatccccacgctggtgccc
tggtgcgtctggggagagagtctgtggaattcctacttcttggcttccattctccgctat
accatctcactcaacatcacctggctggtcaacagcgctgcccacatgtatggaaaccgg
ccctatgacaagcacatcagccctcggcagaacccacttgtcactctgggtgccattggt
gaaggcttccacaattaccaccacaccttcccttttgactactctgcgagtgaatttggc
ttaaatttcaacccaaccacttggttcattgacctcatgtgctggctggggctagccacc
gaccgcaaacgggcaaccaagccaatgatcgaggcccggaaagccaggactggagatggc
agcacttga

DBGET integrated database retrieval system