KEGG   Canis familiaris (dog): 487870Help
Entry
487870            CDS       T01007                                 

Gene name
EIF4E
Definition
eukaryotic translation initiation factor 4E
Orthology
K03259  
translation initiation factor 4E
Organism
cfa  Canis familiaris (dog)
Pathway
RNA transport
HIF-1 signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
Insulin signaling pathway
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:cfa03013]
Environmental Information Processing; Signal transduction; HIF-1 signaling pathway [PATH:cfa04066]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:cfa04151]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:cfa04150]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:cfa04910]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
32
AA seq 230 aa AA seqDB search
MLLRRARELPGLAAGEARKETTPTPNPPPTEEEKTESNQEVANPEHYIKHPLQNRWALWF
FKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKN
KRGGRWLITLNKQQRRSDLDRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWT
TECENREAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgttactccggcgcgcccgagagttgccggggttggcggcaggggaggcgagaaaggaa
accacccctactcctaatcccccgcctacagaagaagagaaaacagaatctaatcaggag
gttgctaacccagaacactatattaaacatcctttacagaacagatgggcactctggttt
tttaaaaatgataaaagcaaaacttggcaagcaaaccttcggctgatctctaagtttgat
actgttgaagacttttgggctctgtacaaccacatccagttgtctagtaatttaatgcct
ggctgtgactactcactttttaaggatggtattgagcctatgtgggaagatgagaaaaac
aaacgaggaggacgatggctaattacattgaacaagcagcagagacgtagtgacctggat
cgcttttggctagagacactgctgtgccttattggagaatcttttgatgactacagtgat
gatgtatgtggagctgttgttaatgttagagctaaaggtgataagatagcaatatggact
actgaatgtgaaaacagagaggctgttacacatatagggagggtatacaaggaaaggtta
ggacttcctccaaagatagtgattggttatcagtcccatgcagacacagctacaaagagc
ggctccactactaaaaataggtttgttgtttaa

DBGET integrated database retrieval system