KEGG   Canis familiaris (dog): 488037Help
Entry
488037            CDS       T01007                                 

Gene name
BDH1
Definition
(RefSeq) 3-hydroxybutyrate dehydrogenase, type 1
  KO
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
cfa  Canis familiaris (dog)
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    488037 (BDH1)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    488037 (BDH1)
Enzymes [BR:cfa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     488037 (BDH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
33
AA seq 326 aa AA seqDB search
CELGLAHCFLLSRRPHFLGRGAPLLPGSRRAFSNEVGSKAVLVTGCDSGFGFSLAKHLHS
KGFLVFAGCLMKDQGGDGVKELDGLKSDRLRTIQLNVCKGEEVERVVEVVRSSLEDPEKG
MWGLVNNAGISTFGEVEFTSMETYKEVAEVNLWGTVQMTKAFLPLIRRARGRIVNISSML
GRMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGNFIAATSLYNPERIQAIA
DKMWDELPEVVRKDYGRKYFDEKIARMQAYCNSGSTDISPVVSAVTHALTSRSPYTRYHP
MDYYWWLRMQIMTHLPGALSDRIYIH
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
tgcgagctgggccttgctcactgcttccttctctcccgcaggccccatttcctgggtcgc
ggcgcccccttgctccccggcagccggcgcgctttctccaatgaggttggcagcaaagct
gtcctggtcacaggctgcgactcgggattcgggttctccttggccaagcatctgcactcg
aaaggcttccttgtgtttgccggctgcttgatgaaggaccaaggaggcgacggggtcaag
gagctggacggcctgaagagcgatcgattaaggaccatccagctcaacgtctgcaaaggc
gaggaggtggagagagtggtggaggtcgtccgctcgagcctggaggaccctgagaaaggc
atgtggggcctggttaacaacgcgggcatctcgactttcggggaggtggaattcaccagc
atggagacctacaaggaggtggcggaggtgaacctctggggcaccgtgcagatgacaaaa
gcctttctcccgctcatccggagggccagaggccgcatcgtcaacatcagcagcatgctg
ggccgcatggccaacccggcccgctccccatactgcatcaccaagttcggggtggaggcc
ttctccgactgcctgcgctacgagatgtacccgctgggcgtgaaggtcagtgtggtggaa
cccggcaacttcattgctgccaccagcctctacaaccctgagcgcatccaggccattgcc
gacaagatgtgggacgagctgcccgaggtggtgcgcaaggactacggcaggaagtacttt
gatgagaagatcgccaggatgcaggcctactgcaacagcggctccacggacatatccccc
gtcgtcagtgctgtcacccacgctctgacctctcgcagcccctacacccgctaccacccc
atggactactactggtggcttcgaatgcaaatcatgacccacttgcccggagccttgtcg
gacaggatctacatacactga

DBGET integrated database retrieval system