KEGG   Canis familiaris (dog): 488252Help
Entry
488252            CDS       T01007                                 

Gene name
HIST1H2BA
Definition
(RefSeq) histone cluster 1, H2ba
  KO
K11252  
histone H2B
Organism
cfa  Canis familiaris (dog)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    488252 (HIST1H2BA)
  Immune diseases
   05322 Systemic lupus erythematosus
    488252 (HIST1H2BA)
  Substance dependence
   05034 Alcoholism
    488252 (HIST1H2BA)
Exosome [BR:cfa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   488252 (HIST1H2BA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
35
AA seq 127 aa AA seqDB search
MPELTSKGTTISKKGFKRAVAKTQKKEGKKRRRCRKESYSVYVYKVLKQVHPDTGISSKA
MGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAV
TKYTSSK
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgccggagctgacttcgaagggcactaccatctccaagaaaggcttcaagagagctgta
gccaaaacccagaagaaagagggaaagaagcgcaggagatgccggaaagagagctactcg
gtgtacgtgtacaaggtgctgaagcaggtgcaccccgacacgggcatctcgtccaaggcc
atgggcatcatgaactcgttcgtcaacgacatcttcgagcgcatcgcgggcgaggcgtcg
cgcctggcgcattacaacaagcgctcgaccatcacgtccagggagatccagacggccgtg
cgcctgctgctgcccggggagctggccaagcacgccgtgtccgagggcaccaaggccgtc
accaagtacaccagctccaagtaa

DBGET integrated database retrieval system